KEGG   Rattus norvegicus (rat): 29302
Entry
29302             CDS       T01003                                 

Gene name
Itgb3
Definition
(RefSeq) integrin beta-3 precursor
  KO
K06493  integrin beta 3
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04015  Rap1 signaling pathway
rno04145  Phagosome
rno04151  PI3K-Akt signaling pathway
rno04380  Osteoclast differentiation
rno04510  Focal adhesion
rno04512  ECM-receptor interaction
rno04611  Platelet activation
rno04613  Neutrophil extracellular trap formation
rno04640  Hematopoietic cell lineage
rno04810  Regulation of actin cytoskeleton
rno04919  Thyroid hormone signaling pathway
rno05163  Human cytomegalovirus infection
rno05165  Human papillomavirus infection
rno05168  Herpes simplex virus 1 infection
rno05205  Proteoglycans in cancer
rno05206  MicroRNAs in cancer
rno05410  Hypertrophic cardiomyopathy
rno05412  Arrhythmogenic right ventricular cardiomyopathy
rno05414  Dilated cardiomyopathy
rno05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    29302 (Itgb3)
   04151 PI3K-Akt signaling pathway
    29302 (Itgb3)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    29302 (Itgb3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    29302 (Itgb3)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    29302 (Itgb3)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    29302 (Itgb3)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    29302 (Itgb3)
   04611 Platelet activation
    29302 (Itgb3)
   04613 Neutrophil extracellular trap formation
    29302 (Itgb3)
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    29302 (Itgb3)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    29302 (Itgb3)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    29302 (Itgb3)
   05205 Proteoglycans in cancer
    29302 (Itgb3)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    29302 (Itgb3)
   05163 Human cytomegalovirus infection
    29302 (Itgb3)
   05165 Human papillomavirus infection
    29302 (Itgb3)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    29302 (Itgb3)
   05410 Hypertrophic cardiomyopathy
    29302 (Itgb3)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    29302 (Itgb3)
   05414 Dilated cardiomyopathy
    29302 (Itgb3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    29302 (Itgb3)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    29302 (Itgb3)
   04515 Cell adhesion molecules [BR:rno04515]
    29302 (Itgb3)
   04090 CD molecules [BR:rno04090]
    29302 (Itgb3)
Membrane trafficking [BR:rno04131]
 Endocytosis
  Phagocytosis
   Integrins (complement receptors)
    29302 (Itgb3)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   29302 (Itgb3)
Cell adhesion molecules [BR:rno04515]
 Integrins
  Integrin beta subunits
   29302 (Itgb3)
CD molecules [BR:rno04090]
 Proteins
  29302 (Itgb3)
SSDB
Motif
Pfam: Integrin_beta Integrin_b_cyt Integrin_B_tail I-EGF_1 PSI_integrin EGF_2
Other DBs
NCBI-GeneID: 29302
NCBI-ProteinID: NP_714942
RGD: 628868
UniProt: Q8R2H2
Position
10
AA seq 787 aa
MRTRRPGQLWATLLALGALAGVVVGESNICTTRGVNSCQQCLAVSPVCAWCSDESLPQNS
PRCNLKKNLLKDKCSPESIEFPVSEAQILEALPLSSKGSGDSAQITQVSPQRIALRLRPD
DSKIFSLQVRQVEDYPVDIYYLMDLSFSMKDDLSSIQTLGTKLASQMRKLTSNLRIGFGA
FVDKPVSPYMFISPPQAIKNPCYTMKSTCLPMFGYKHVLTLTDQVTRFNDEVKKQSVSRN
RDAPEGGFDAIMQATVCDEKIGWRNDASHLLVFTTDAKTHIALDGRLAGIVLPNDGRCHI
GPDNHYSASTTMDYPSLGLMTEKLSQKNINLIFAVTENVVSLYQNYSELIPGTTVGVLSD
DSSNVLQLIVDAYGKIRSKVELEVRDLPEELSLSFNATCLNNEVIPGLKSCVGLKIGDTV
SFSIEAKVRGCPQQKEQSFTIKPVGFKDSLTVQVTFDCDCDCQAFAQPLSPRCNNGNGTF
ECGVCRCDQGWLGSMCECSEEDYRPSQQEECSPKEGQPICSQRGECLCGQCVCHSSDFGK
ITGKYCECDDFSCVRYKGEMCSGHGQCNCGDCVCDSDWTGYYCNCTTRTDTCMSTNGLLC
SGRGNCECGSCVCVQPGSYGDTCEKCPTCPDACSFKKDCVECKKFNRGKLHEENNCNRFC
RDDIELVKELTDTGKNAVNCTYKNEDDCVVRFQYYEDSSGRAVLYVVEEPECPKGPDILV
VLLSVMGAILLIGLATLLIWKLLITIHDRKEFAKFEEERARAKWDTANNPLYKEATSTFT
NITYRGT
NT seq 2364 nt   +upstreamnt  +downstreamnt
atgcgaacgcggcggccgggacagctctgggccactctgctggcgctgggggcgctggcg
ggcgttgtcgtcggagagtccaacatctgtaccacgagaggcgtgaactcctgccagcag
tgtctggccgtaagtcccgtgtgtgcctggtgctcagatgagtctctgcctcagaactcg
ccccgctgtaacctgaaaaagaacctgctgaaggataagtgctccccagagtctattgag
ttcccagtcagcgaggcccagatcctggaagctcttccgctcagcagcaagggctcagga
gacagcgcccagatcactcaggtcagcccccagaggatcgcccttcggctgcggccagat
gattcgaagatcttttcactccaagtgcggcaggtggaggattaccctgtagacatctac
tacttgatggatctgtctttctccatgaaggatgatctgtccagcatccagaccctgggt
accaagttggcctctcagatgcgcaagcttaccagcaaccttcggattggctttggggcc
tttgtggacaagcccgtgtctccatacatgttcatctccccaccacaggcgatcaaaaac
ccctgttacactatgaagagtacctgcttgcccatgtttggctacaaacatgtgctaaca
ctaaccgaccaggtgacccgcttcaatgacgaagtgaagaagcagagtgtgtcacgtaac
cgagatgccccagagggcggctttgacgccatcatgcaggctacagtctgtgatgaaaaa
attggctggaggaatgatgcatcccatttgctggtgtttaccactgatgccaagacccat
attgccctggacggaaggctggcaggcattgtcttgcccaatgatgggcgctgccacatt
ggcccggacaaccactactctgcttccactactatggattacccatctctggggctgatg
actgagaaactatcccagaagaacattaacttgatctttgcagtgaccgaaaatgtcgtc
agcctttaccagaattacagtgagctcatcccggggaccacagtgggagtcctgtctgat
gactcaagcaatgtccttcagctcatcgttgatgcttacgggaaaatccgttctaaagtg
gagctggaagtgcgtgatctccccgaagagctgtcgctgtccttcaatgccacctgcctc
aacaacgaggtcatcccaggcctcaagtcttgtgtgggcctcaagattggagacacggtg
agcttcagcatcgaggccaaggtgcgtggctgcccccagcagaaggagcaatctttcact
attaagcctgtgggctttaaggacagccttacagtccaggtgaccttcgactgtgactgt
gactgccaggcctttgcccagcctctcagcccacgctgcaacaatggtaacggaaccttt
gagtgtggggtgtgccgctgtgatcagggctggctgggctccatgtgtgagtgctccgag
gaggactatcgaccctctcagcaggaagagtgcagccccaaggaaggccagcccatctgc
agccagcggggcgagtgcctctgtggccagtgcgtctgccacagcagtgactttggcaag
atcaccggcaagtactgtgagtgtgatgacttctcctgtgtccgctacaaaggggagatg
tgctctggccatggccagtgcaactgtggggactgcgtgtgtgactcggactggactggc
tactactgcaactgcacaacacgcaccgacacctgcatgtccaccaacgggctgctgtgc
agcggccggggcaactgtgagtgtggcagctgtgtgtgcgtccagccaggctcctatgga
gacacctgtgagaagtgtcccacctgcccagatgcctgctcatttaagaaggactgtgtg
gagtgtaagaagttcaaccggggaaagctacatgaagaaaacaactgcaaccgtttctgc
cgagatgacatcgagctggtgaaagaactgacggatactggcaaaaacgcggtgaactgt
acctacaagaatgaggacgactgtgtcgtcagattccagtactatgaagactccagtgga
agggctgtcctgtatgtggtagaagagcctgagtgtcctaagggtcctgatatcctggtg
gtcctgctgtcagtgatgggggcgattctgctcattggccttgctactctgctcatctgg
aagctactcatcaccattcatgaccggaaggaatttgctaaatttgaggaagaacgagcc
agagccaaatgggacacagcaaacaacccattgtataaagaggccacctccaccttcacc
aatatcacctaccgggggacttaa

KEGG   Rattus norvegicus (rat): 296456
Entry
296456            CDS       T01003                                 

Gene name
Itgav
Definition
(RefSeq) integrin alpha-V isoform X1
  KO
K06487  integrin alpha V
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04145  Phagosome
rno04151  PI3K-Akt signaling pathway
rno04510  Focal adhesion
rno04512  ECM-receptor interaction
rno04514  Cell adhesion molecules
rno04810  Regulation of actin cytoskeleton
rno04919  Thyroid hormone signaling pathway
rno05163  Human cytomegalovirus infection
rno05165  Human papillomavirus infection
rno05200  Pathways in cancer
rno05205  Proteoglycans in cancer
rno05222  Small cell lung cancer
rno05410  Hypertrophic cardiomyopathy
rno05412  Arrhythmogenic right ventricular cardiomyopathy
rno05414  Dilated cardiomyopathy
rno05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    296456 (Itgav)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    296456 (Itgav)
   04514 Cell adhesion molecules
    296456 (Itgav)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    296456 (Itgav)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    296456 (Itgav)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    296456 (Itgav)
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    296456 (Itgav)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    296456 (Itgav)
   05205 Proteoglycans in cancer
    296456 (Itgav)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    296456 (Itgav)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    296456 (Itgav)
   05165 Human papillomavirus infection
    296456 (Itgav)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    296456 (Itgav)
   05410 Hypertrophic cardiomyopathy
    296456 (Itgav)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    296456 (Itgav)
   05414 Dilated cardiomyopathy
    296456 (Itgav)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    296456 (Itgav)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    296456 (Itgav)
   04515 Cell adhesion molecules [BR:rno04515]
    296456 (Itgav)
   04090 CD molecules [BR:rno04090]
    296456 (Itgav)
Membrane trafficking [BR:rno04131]
 Endocytosis
  Phagocytosis
   Integrins (complement receptors)
    296456 (Itgav)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   296456 (Itgav)
  Exosomal proteins of epithelial cells
   296456 (Itgav)
Cell adhesion molecules [BR:rno04515]
 Integrins
  Integrin alpha subunits
   296456 (Itgav)
CD molecules [BR:rno04090]
 Proteins
  296456 (Itgav)
SSDB
Motif
Pfam: Integrin_alpha2 FG-GAP FG-GAP_3 Integrin_alpha LYRIC DctQ Collectrin
Other DBs
NCBI-GeneID: 296456
NCBI-ProteinID: XP_038962373
RGD: 1310613
Ensembl: ENSRNOG00000004912
Position
3
AA seq 1043 aa
MADPGRLLLRPRPGGLLLLLLGLLLPFAGSFNLDVESPAEYAGPEGSYFGFAVDFFVPST
SSRMFLLVGAPKANTTQPGIIEGGQVLKCDCSSSRRCQPIEFDSTGNRDYAKDDPLEFKS
HQWFGASVRSKQDKILACAPLYHWRTEMKQEREPVGTCFLQDGTKTVEYAPCRSKNIDAD
GQGFCQGGFSIDFTKADRVLLGGPGSFYWQGQLISDQVAEIISKYDPNVYSIKYNNQLAT
RTAQAIFDDSYLGYSVAVGDFNGDGIEDFVSGVPRAARTLGMVYIYDGKNMSSLHNFTGE
QMAAYFGFSVAATDINGDDYADVFIGAPLFMDRGSDGKLQEVGQVSVSLQRASGDFQTTK
LNGFEVFARFGSAIAPLGDLDQDGFNDIAIAAPYGGEDKKGLVYIFNGRSTGLNSVPSQI
LQGQWAAQSMPPSFGYSMKGATDVDRNGYPDLVVGAFGVDRAVLYRARPVVTVNAGLEVY
PSILNQDNKICPLPGTALKVSCFNVRFCLKADGKGTLPRKLNFQVELLLDKLKQKGAIRR
ALFLHNRSPGHSKDMTVFRGGQTQCEELVAYLRDESEFRDKLTPITIFMEYRLDQRTAAD
ATGLQPILNQFTPANVSRQAHILLDCGEDNVCKPKLEVSVDSDQKKIYIGDDNPLTLTVK
AQNQGEGAYEAELIVSIPPQADFIGVVRNNEALARLSCAFKTENQTRQVVCDLGNPMKAG
TQLLAGLRFSVHQQSEMDTSVKFDLKIQSSNSFDNVSPVVSYKVDLAVLAAVEIRGVSSP
DHIFLPIPNWEYKETPETEEDVGPVVQHIYELRNNGPSSFSKAILNLQWPYKYNNNTLLY
ILHYDIDGPMNCTADTEINPLRIKTPEKNDTAAEQGGRNHLITKRDLSLSEGDVHTLGCG
TAQCLQITCQVGRLDRGKSAILYVKSLLWTETFMNKENQNHSYSLKSSASFNIIEFPYKN
LPIEDLFNSTLVTTNITWGIQPAPMPVPVWVIILAVLAGLLLLAVLVFVMYRMGFFKRVR
PPQEEQEREQLQPHENGEGNSET
NT seq 3132 nt   +upstreamnt  +downstreamnt
atggctgatcccgggcggctgctgctacgccctcgccccggtggcctcctgctcctgctg
ctcggcctcctactgcccttcgccggctccttcaacctggacgtcgaaagccccgccgag
tacgccggccccgagggaagttacttcggattcgccgtggacttcttcgtgcccagcacg
tcctccaggatgttcctcctggtgggagccccaaaagcaaacacaacccagcctgggatt
atagaaggagggcaagttctcaaatgtgactgctcatccagccgccggtgccagcccatt
gaatttgattcaacaggcaatcgagattatgccaaagatgacccactggagtttaaatcc
caccagtggtttggagcctccgtgaggtcaaagcaggataaaatcttggcctgtgctcca
ttgtaccactggaggactgagatgaagcaggagagagagccagttggaacctgctttctt
caggatggcacaaagaccgttgagtatgctccatgcaggtcaaaaaatattgatgctgat
ggacagggattttgtcaaggaggattcagcattgattttactaaagccgacagagtactt
cttggaggtcccggcagcttttattggcagggtcagctcatttcagatcaagtggcagaa
atcatatctaaatatgacccaaatgtctacagcatcaaatataataaccaactagccaca
cggactgcacaagcaatttttgatgacagttatttgggttactctgtggccgtgggagac
ttcaatggtgacggcattgaagattttgtttctggagttccaagagcagcaaggactttg
ggaatggtttatatttatgatgggaaaaacatgtcttcattacacaattttactggtgaa
cagatggctgcatattttggattttctgtagctgctactgacattaatggggatgattat
gcagatgtgtttattggagcccctctgttcatggaccgaggttctgatggaaaactccag
gaggtcggccaggtctcagtgtctctacagagagcgtcgggagacttccagactacaaag
ctgaacgggtttgaggtttttgccagatttggaagtgccatagctcctttgggagacctg
gaccaggatggcttcaatgacattgcaattgctgctccatatggtggcgaagataaaaag
ggacttgtttatatcttcaatggaagatccacaggcttgaattcggtgccatctcaaatc
ctgcaggggcagtgggccgctcagagcatgcccccaagctttggctattcaatgaaggga
gctacagatgtagatagaaatggatatccagacttagttgtcggagcttttggtgtggac
cgagctgtcttatacagagccagacctgttgtcaccgtaaatgctggccttgaagtgtac
cctagcattttaaatcaagacaataaaatctgcccattgcctgggacagctctcaaggtt
tcctgttttaatgtcaggttctgcttaaaggcggatggcaaagggacacttccgaggaaa
ctcaacttccaggtggagcttcttttggataaactcaagcagaagggagccatccggcga
gcactgtttctccataacaggtccccggggcactctaaggacatgactgttttcaggggg
ggacagacgcagtgtgaggaactggtcgcctatcttcgggatgaatctgagtttagagac
aagctcactcccatcactatttttatggagtatcggctggaccagagaacggctgctgat
gccacaggcttgcagcccatcctgaaccagttcactccggccaacgtcagtcggcaggct
cacattttacttgactgtggcgaagacaatgtctgtaaacctaaactggaagtttctgta
gatagtgatcaaaagaagatctatattggggatgacaaccctctgaccctgaccgtgaag
gcgcagaatcaaggagaaggcgcctatgaagctgagctcatcgtttctatcccaccacag
gctgacttcatcggggttgtccggaacaacgaagccttagcaagactgtcctgtgcattt
aagacagaaaaccaaacccggcaggtggtgtgtgaccttgggaacccgatgaaggctgga
actcaactgcttgctggccttcgtttcagcgtgcaccagcaatcagagatggatacttct
gtgaagtttgacttgaaaatccaaagctctaattcttttgacaatgtcagcccagtcgtg
tcttacaaggtcgaccttgccgttttggctgccgttgagataagaggagtttcaagccca
gatcacatctttcttccaattccaaactgggagtacaaggaaacccctgagactgaagaa
gacgttgggcctgttgttcagcacatctatgagctgagaaacaatggtccaagttcattc
agcaaggcaatcctgaacctccagtggccttacaaatacaacaacaatactttgctgtac
attctccattacgacattgatgggccgatgaactgtactgccgacacagagatcaaccct
ctgagaattaagacgcccgaaaagaatgacacagcagctgagcaaggaggaagaaatcat
ctcatcaccaagcgggatctcagcctcagtgagggagatgttcacactttgggctgtgga
actgctcagtgcttgcagatcacctgccaggtcggtcgactggatagagggaagagcgcc
atcctgtacgtgaaatccctgctgtggaccgagacgtttatgaacaaggagaaccagaac
cattcctattccctgaagtcatccgcttcatttaatatcatagaattcccttacaagaat
cttccgattgaggatctcttcaactctacgctagtcaccacgaacatcacctggggcatt
cagccagcacccatgcctgtgcctgtgtgggtgatcatcttggcggttctcgcagggctg
ctgttactggccgtgttggtatttgtaatgtacaggatgggctttttcaaacgtgtccga
ccacctcaagaagagcaagaaagagaacagcttcagcctcatgagaacggcgaaggaaac
tctgaaacctaa

DBGET integrated database retrieval system