KEGG   Rattus norvegicus (rat): 293024
Entry
293024            CDS       T01003                                 

Gene name
Akap13
Definition
(RefSeq) A-kinase anchor protein 13
  KO
K16529  A-kinase anchor protein 13
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04928  Parathyroid hormone synthesis, secretion and action
rno05163  Human cytomegalovirus infection
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09152 Endocrine system
   04928 Parathyroid hormone synthesis, secretion and action
    293024 (Akap13)
 09160 Human Diseases
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    293024 (Akap13)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    293024 (Akap13)
Membrane trafficking [BR:rno04131]
 Others
  Rho GTPase associated proteins
   Rho guanine nucleotide exchange factors (GEFs)
    293024 (Akap13)
SSDB
Motif
Pfam: RhoGEF PH_16 C1_1 Prok-RING_1 PH C1_2 RII_binding_1 zf-ribbon_3
Other DBs
NCBI-GeneID: 293024
NCBI-ProteinID: NP_001099741
RGD: 727893
Ensembl: ENSRNOG00000010964
UniProt: F1M3G7
Position
1
AA seq 2760 aa
MKLSPQQAPLYGDCVVTVLLAEEDKVEDDAIFYLIFSGSTLYHCTSTRKVSSDTLETIAP
GHDCCETVKVLLCASKEGLPVFVVAEEDFHFVQDEAYDAAQFLATSAGNQQALNFTRFLD
RSGPPSGDVNSLDEKVALAFRHLKLPAEWNVLGTDHTLHDGGPRETLMHFAVRLGLLRLT
WFLLQKPGGRGALSIHNKEGATPVSLALERGYHKLHQLLTEENAGEPDSWSSLSYEIPYG
DYSVRHHRELDIYTLTSESESHCEPHGDSCTGHISKLMNIQQQLMKTNLKQMDNLMPLMV
TTQDSSCVPCVPEPSDHQQLPFEETKSTVCCQGSPGRKDASPCDLSSVVEEENLICSHKK
NKDTGRPGEGVEPASAVDSRSASHQDSCLQSIPDCGVKGREGLPSCGNRNEVTGTQYSGV
ATCQQPLSSESSVPQDVLVTEPDARQHSSGRELPDSSSTDAGAPEKAGELEHSLLTPDAT
TQNSKPQVGESAKERLENSDISSAEATAVQALREPKQKADVTNHVFAARAAGADAPAEAS
PAWSPEEIPTGKPGMETQERGCEGGITSDQSSQVLPAAAAATENKVLDGLELETLPACPC
ETASSLDLTVSGPRPDGMPKQNSESSAQHAQSLNSQAPLCSIAGAGTPSAESACPQSTET
SSGGSVIEHGSGEASLPESTAAQPEPQGLCTAPCPEDPQADTVTSDTAAHNQKSVGSCHL
CALDAKNQEKDLRQDTPSVNTLEDVPHLPSVVPQSEEKLEPDQVSPRGSSFSLASSPESE
SVTKDDVLSLVSSQKEKGTATPQLHRAPACSDGPDGRDLNDTDKVGDGAASPPTPSAVEL
QTSMGNTSPVGVGEQEGSSLTATLEVLSDSLLQSVDKAALVSDSLLPEEGGSIVVPESST
ALGQGGKDKATKCPSVKEDVHSSEMSREDQRTPPPGQEISRLCEKPMSALCAGEKALQHS
NSPDTPSACLQTETKHNKEVAPQSSPLMKGGAVQNLVPPKTSLSADSEQKTSSTEQSGSS
LLPGGASEALRCSQPSLSVSVESIQFQGKTSACKVSRNAMEDVTVADAFLATAEPTKEDA
LHHVKDISDLLNQEKKTTPGLPEALLDKGVTDLQEVITPEIEPLDCKREKLEGTDLSCPT
SKSKETPNNEETTQPPARDLPTETGLSAINDNGPQADMKHVTQASVPGEESNVTTVLGMV
STQAADGPPGADSIEETATRIVEAVIKQIKASNTLRTQVEIQNPPLSSSEIKEIENTGSE
SARVFLPGEPLQMENTQKETTGHCSVETEAPEKIILAVHRPEPAPEMPDTKTGGEVDLLS
KRSAASEEEAIGNGAATPKMKQAPGTQVINRESWCAIEPCPEAASLLASKQSSECRSFID
VGLGTECATKEGVLQRESGSDSDLFHSPSDEMDSIIFSKPEEEQLLCDTTGSSSSTDDTA
SLDRHSSHGSDVSLPQTSKLNRSRNHQSSNGFFSHGVDPESREGESEPAGSGEMEEEEMD
SITEVPANRSFLRNSMRSLSPFRRHSWGPGKNAASDAEMNQRSSMQVLGHVVRRPPIHRR
SMSWCPSGVQYSAALNADFNIRSFSLEGLTGGGGVGNKPSSSLEISSANSSELRNPFSGE
EQRSSLMSLSEEHLEPDQRQHHRMFDQQTCYRSKQQGFNYCTSAISSPLTKSISLMTISH
PGLDNSRPFHSASANLTESITEENCNFLPPSPSKKSFEEKSGTKVSRTFSYIRNKMSSSK
KSKKEKDKKTLNGHTFSPIPIVGPINCSQCMKPFTNKDAYTCASCGAFVHKGCRENLASC
AKVKMKQPKGSLQAHDTSSLPTVIMRNKSSQPKERPRSAVLLAEEAIAAPMFTNRRSQQS
VSLSKSVSIQNITGVGNDENMSNTWKFLSHSTDSLNKICKVNESTESLTDEGVGTDMNEG
QLMGDFESDSKQLEAESWSRTVDSKFLKQQKKDVVKRQEVIYELMQTELHHIRTLKIMSD
VYSRGMMTDLLFEQQMVEKLFPCLDELISIHSQFFQRILERKKESLVDKSEKNFLIKRIG
DVLVSQFSGENAERLKKTYGKFCGQHNQSVNYFKDLYTKDKRFQAFVKKKMSSSVVRRLG
IPECILLVTQRITKYPVLFQRILQCTKDNEVEQEDLTQSLSLVKDVIGAVDSKVASYEKK
VRLGEIYTKTDSKSIMRMKSGQMFAKEDLRRKKLVRDGSVFLKSATGRLKEKDQKYVFAS
LDHKSTVISLKKLIVREVAHEEKGLFLISMGVKDPEMVEVHASSREERNSWIQIIQDTIN
SLNRDEDEGIPSENEEEKRLLDTKARELKEQLQQKDQQILLLLEEKEMIFRDMTECSTPL
PEDCSPTHSPRMLFRSNTEEALKGGPLMKSAISEVEILQGLVSGSLGGTLGQPISSPVEQ
EVMAGPISLPRRAETFGGFDCHQLNASKGGEKEEGDDGQDLRRTESDSGLKKGGNANLVF
MLKRNSEQVVQSIVHLHELLTMLQGVVLQQDSYIEDQKLVLTEKVLTRSASRPSSLIEQE
KQRSLEKQRQDLANLQKQQAQHLEEKRRREREWEARELELRDREAKLAEREETVRRRQQD
LERDREELQQKKGTYQCDLERLRAAQKQLEREQEQLKRDAEQLSQRQMEQDLCQVSNKHG
RLMRVPSFLPNSDEFSLLSTPSITKSGSLDSELSVSPKRNSISRTQKDKGPFHILSSASQ
TKVPEGQSQAPSSTSTSTRLFGLSKPKEKKEKKKKSKGSRTQPGDGPAPEVPAEGEEIFC
NT seq 8283 nt   +upstreamnt  +downstreamnt
atgaaacttagtccacaacaagctccattatatggcgattgtgttgttacagtcctgctt
gctgaagaggacaaagttgaagatgatgctattttttacttgatattttctggctctacc
ctctatcactgcacaagtacccggaaagtcagttctgatacgttggagacaattgctcct
ggtcatgactgctgtgagacggtgaaggtgctactctgtgcttccaaagagggccttcct
gtgtttgtagttgctgaagaagacttccattttgtccaggatgaggcatatgatgcagct
cagttcctggcaaccagtgctggaaatcagcaggctctgaacttcacacggttccttgat
cgatcaggacccccttctggagatgtgaactctctggatgagaaggtcgcactggcattc
agacacctgaagctgcctgcagagtggaatgtgttagggacggatcacacgttgcatgat
ggtggccctcgggaaaccctcatgcattttgctgtgcggcttggattgctgcggttgaca
tggttcctgttacagaagccaggtggccgtggagctctcagcatccacaacaaggaaggg
gcaacgcctgtaagcctggcactggagcgaggttatcacaagcttcaccagctcctgact
gaggaaaatgctggtgaaccagattcctggagcagcttatcctatgaaatcccttatgga
gactattcagtgaggcaccatcgagaattggacatctatacattgacttccgaatctgaa
tcacattgtgaaccgcatggagacagttgtactggacatatttctaaacttatgaatatc
cagcagcagctaatgaaaacaaacttgaagcagatggacaatctcatgcccttaatggtg
acaacacaagattcatcttgtgtgccctgtgtaccagagccttctgaccaccagcagctt
ccttttgaagaaactaagagcactgtgtgctgccaagggagtcctgggaggaaggatgca
agtccctgtgacttgtcaagtgtggttgaggaagaaaatctcatctgttctcataagaaa
aataaagatactgggagaccaggggaaggggtggagccagcgtctgcggtggactctagg
tctgcatctcatcaagacagctgccttcagagcatacccgactgtggagtgaagggtaga
gaaggcctgccatcctgtggaaacagaaacgaagtaactggaacacaatattctggagtt
gccacgtgtcagcagcccctgagcagcgagagcagtgtgccgcaggatgtcctggtcaca
gaaccagatgcgcgccagcactcttctggaagggagctaccagacagttcttcaacagat
gctggtgccccagaaaaggcaggagaactagaacatagcctacttaccccagatgctacc
acccagaacagtaagcctcaagtaggggaaagcgcaaaggagagacttgagaattccgac
attagctccgccgaggcgactgctgttcaagctttacgtgaacccaagcagaaagctgac
gttacaaaccatgtctttgccgcccgtgctgcgggtgctgacgctcctgctgaggcttca
cctgcatggagtcctgaagaaatccccactggaaaaccaggaatggagactcaggagaga
ggctgtgaggggggcatcacaagtgaccagagctcccaggtgcttcctgctgctgctgct
gctacagaaaacaaggttttagatggactagaacttgaaactcttccagcatgcccttgt
gagacagcatcatccttggatttaaccgtgtcagggccaagaccagatgggatgccaaaa
caaaactcagagtctagtgctcagcatgctcagagcctgaatagccaggccccgctctgc
tctatcgcaggggccggcacgccctctgctgagtctgcgtgtccgcagagcacagagacc
tctagtggcgggtcggtaatagagcatggcagtggcgaagctagcctgcccgaaagcaca
gcagcgcagccagaaccgcaaggtctttgcaccgccccctgcccagaagacccacaagct
gacacagtcacttctgacactgcagcacacaaccagaaatctgtggggtcttgtcatctc
tgtgctttagatgcaaagaaccaagaaaaagatttgagacaagatacaccctcagtgaac
acgcttgaggatgttccacatctgccttcagttgtcccccaatctgaggaaaaactagag
ccagaccaggtatcacctcgaggcagcagtttctctctggcaagcagtccagagagtgaa
tcagtaaccaaagatgacgtactttctctcgtctcctcccagaaagaaaagggaacagca
actcctcagctccatagagctccagcttgtagtgatggcccagatggaagagatctgaat
gatacggataaggtaggagacggggctgccagcccacctacaccctctgctgtagagctt
cagaccagcatggggaataccagccctgtaggtgttggagagcaggaggggtccagccta
acagcaacacttgaagtgctaagtgactccttgctacaaagcgtggataaggctgctttg
gtctctgactctcttctgcctgaagaaggtggcagtatagtggttccagaaagttccaca
gctctggggcaaggtggcaaagacaaagcaacgaaatgtccttctgttaaagaagatgtg
cattcttcagaaatgtcaagggaggaccagagaacaccacctcctgggcaggagatatca
agattatgtgaaaaacctatgtcagccctgtgtgccggggagaaagcgctgcagcacagt
aactcgccagacacaccctctgcctgtctgcaaacagaaactaaacacaacaaggaagtg
gccccacagagctccccgctgatgaaaggtggggctgtacagaacctggtgccaccaaaa
acaagtctgtctgccgattcagagcagaaaacctcgagtacagagcagagtggctcatct
ctgctgccaggtggtgcgtctgaggcactccgctgtagtcagccttcgctcagtgtcagc
gtggagagcattcagttccaagggaaaaccagtgcttgtaaggtaagcagaaatgcaatg
gaggatgttacagtggctgatgctttcctagctactgctgagcccacaaaagaggatgca
ttacaccacgtcaaagacatttcagacttgttaaaccaagagaagaaaacgactccaggt
ttgccagaagctttactggacaaaggtgtcactgacttacaggaagtcataaccccagag
atagaaccacttgattgcaagagagagaaactggagggaacagaccttagctgtcccaca
agtaaatccaaagagactccaaacaatgaagaaacaacgcaacctcctgccagggacctc
cccacagagacagggctctcagctatcaatgacaatggcccccaagctgacatgaagcac
gtgactcaggcatcggtcccaggagaggaaagtaacgttaccactgtacttggaatggtc
tcaacccaagctgcagatgggcctcctggagcagactccatagaggagaccgccactagg
atcgtggaggccgtcatcaagcagatcaaggcctccaacacactaaggacacaagtagaa
atccagaatccgccactgtccagttcagagattaaggagatagagaacactggttcagag
agtgcacgtgttttcctacccggggagcccctgcagatggagaatactcagaaagaaacc
actggacactgtagtgttgagacagaggcaccagagaaaataattctagctgtccacagg
cctgagccagcaccagaaatgccagacactaaaactggaggtgaagtggatcttctgagt
aagcgcagtgctgcttctgaggaggaggctataggaaatggagctgccacgcccaagatg
aagcaagccccagggacccaggtgatcaaccgagaaagctggtgtgccatagagccctgc
cctgaagcagcatctctcttagcttccaaacagagctcagaatgcagaagcttcatagat
gttggactgggcacggagtgtgccacaaaagaaggcgtgctccagagagagtcagggagt
gattctgacctctttcactcacccagtgatgaaatggacagcatcatcttctcaaagcct
gaggaagagcagttgctttgtgatacaacaggatccagttcttcaacagatgacacagct
tccctggatcgacattcttctcatggcagtgatgtgtcccttcctcagacgtcaaagtta
aacaggtccagaaatcatcaaagttccaatggctttttcagccatggggtggaccctgag
agtcgggaaggtgagagcgagcctgctggctctggtgaaatggaagaggaggagatggac
agcatcactgaagtgcctgcaaaccgctcttttctgaggaactccatgcgctctctttct
cctttccggaggcacagctggggacctgggaagaatgcagccagtgatgcagaaatgaac
cagcggagttcaatgcaagttcttgggcatgttgtcaggagacctcccattcataggaga
agtatgagctggtgtccctctggtgtgcagtactcggctgccctgaatgctgactttaat
atcagaagtttcagtctggaaggcttgacaggaggaggtggtgttggaaataagccatcc
tcatctctagaaataagctctgcaaactccagcgagctcagaaaccctttcagtggtgag
gagcagaggagctctttgatgtcgctttcagaagaacacctggaaccggaccagagacag
caccataggatgtttgaccagcagacatgttacaggtctaaacaacagggatttaactac
tgtacatcagctatttcttctccattgacaaaatccatctcattaatgacaatcagtcat
cctggattagacaattcacggcccttccacagtgccagtgccaacctgacagagagtata
acagaagagaactgtaatttcctgcctccaagcccctcaaaaaagagttttgaagaaaag
agtgggactaaggttagtcgcaccttcagctacatcaggaataaaatgtccagcagcaag
aagagcaaaaaggaaaaagataaaaagactcttaacgggcacactttcagccccattcct
attgtgggtcccatcaactgcagccagtgcatgaagcctttcaccaacaaggacgcctac
acatgtgcaagttgtggtgcttttgtccacaaaggctgcagagaaaatttagcctcctgt
gcaaaggtcaaaatgaagcagccgaaggggagcctccaggcacacgatacatcatcgctg
cccacagtcatcatgagaaacaagtcttcacagcccaaggagcgccctaggtctgcagtc
ctcttggctgaagaggccattgctgcaccaatgtttactaacagaaggtcccagcagagt
gtctccctctctaaaagtgtctccatacaaaacattactggagttggcaacgatgagaac
atgtcaaacacctggaaatttctgtctcattcaacagactcactgaataaaatctgcaag
gtcaatgagtcaacagaatcccttactgatgagggagtaggtacagacatgaatgaagga
cagctgatgggagattttgaaagcgactctaaacagctagaagcagagtcatggagccgg
acagtggacagcaagttccttaaacagcagaagaaagatgtggtcaagcggcaggaagtg
atttacgagttgatgcagactgagttacatcacatccgcacactgaagatcatgagtgac
gtgtacagccggggcatgatgacagatctgctctttgagcagcagatggtggaaaagctg
ttcccctgtttggatgaactgatcagtatccacagccagttctttcagagaatcctggag
cggaagaaggagtctctggtggataaaagtgaaaagaactttctcatcaagaggataggg
gatgtgcttgtcagtcagttctcaggtgagaatgcagagcgtttaaagaagacatatggc
aagttctgtggacagcacaaccagtctgtcaactacttcaaagacctgtacaccaaggat
aagcgtttccaagcctttgtgaagaagaagatgagcagttcagtagtaagaagactggga
atcccagagtgcattttacttgtaactcagaggatcaccaagtacccagttttattccaa
aggatactgcaatgtaccaaagacaatgaagtggagcaggaagacctcacccagtccttg
agcctggtgaaggatgtgattggagccgtggacagcaaagtagcaagttatgagaagaaa
gtgcgtctcggtgagatttacacaaagacagatagcaagtcgatcatgagaatgaagagt
gggcagatgttcgccaaggaggatctgagacggaagaagctggtgcgggatggaagtgtg
tttctcaagagcgcaacaggaaggctgaaagaaaaagaccagaaatacgtatttgcatca
ttggaccacaagtcaacagtgatctccttaaagaaactgattgtaagagaagttgcccat
gaggagaaaggcctgttcctcatcagtatgggggtgaaagatccagagatggtggaggtc
catgcaagctccagagaggagcggaatagctggattcagatcattcaggacacaatcaac
tccttgaacagagatgaagatgaagggattcccagtgaaaatgaagaagaaaagagattg
ttggataccaaagcccgggagttaaaagaacaacttcagcagaaggaccagcagatcctc
ctcttgctggaagagaaggagatgattttccgggacatgactgagtgcagcactccctta
cctgaggattgctccccaacacacagcccgagaatgctcttccgctccaacacagaggag
gctctcaaaggaggaccgctgatgaaaagtgcaatcagcgaagtggaaatccttcagggg
ttggtgagtggaagccttggtggcacacttgggcagcccatcagcagccctgttgagcag
gaagtcatggctgggcccatttctttgccccggagagcagagacctttggaggatttgac
tgtcatcagctgaatgcttccaaaggaggtgagaaagaagagggtgatgatggccaagat
cttaggagaacagaatctgatagtggcctgaaaaagggtggaaatgctaacctggtattt
atgcttaaaagaaacagtgagcaggttgtccagagcattgtgcacctccacgagctcctt
accatgctgcagggtgttgtgctacaacaagacagctacattgaggaccagaagctggtg
ctgacagagaaggtactcacaaggagtgcatcccgccccagctctctcattgagcaggag
aagcagcggagcctggagaagcagcgccaggacctggccaacctgcagaagcagcaggca
cagcacctggaggaaaagcgacgacgtgaacgtgagtgggaggcccgtgagctggagctt
cgagaccgagaggccaagctggctgagcgggaagagacagtccgtcgtaggcagcaggac
ctggagagggaccgcgaagagctccagcagaagaagggcacttaccagtgtgatctagag
agactacgggctgcccagaaacagctggaacgggagcaggaacaactgaagagggatgca
gagcagctcagccagaggcagatggagcaggacctttgccaggtttcaaataaacatggc
agactgatgcgggtcccgtccttcttgcccaattcggatgagttctccttgctgtctaca
ccttctataaccaaatcgggctcactggactcagaactctcagtgtctcctaaaaggaac
agcatctctcggacacagaaagataaggggcctttccatatactgagctcagccagccaa
acaaaagtaccagaggggcagagccaggccccgtccagcacctccacttccacccgactc
tttggattatctaagccaaaggaaaagaaggagaagaaaaagaagagcaaaggaagccgc
actcagcctggtgatggtcctgctccagaagtaccagcagagggtgaagagatcttctgt
tga

KEGG   Rattus norvegicus (rat): 367072
Entry
367072            CDS       T01003                                 

Gene name
Arhgef12
Definition
(RefSeq) rho guanine nucleotide exchange factor 12
  KO
K07532  Rho guanine nucleotide exchange factor 12
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04270  Vascular smooth muscle contraction
rno04360  Axon guidance
rno04611  Platelet activation
rno04625  C-type lectin receptor signaling pathway
rno04810  Regulation of actin cytoskeleton
rno05135  Yersinia infection
rno05152  Tuberculosis
rno05163  Human cytomegalovirus infection
rno05200  Pathways in cancer
rno05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    367072 (Arhgef12)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    367072 (Arhgef12)
   04625 C-type lectin receptor signaling pathway
    367072 (Arhgef12)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    367072 (Arhgef12)
  09158 Development and regeneration
   04360 Axon guidance
    367072 (Arhgef12)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    367072 (Arhgef12)
   05205 Proteoglycans in cancer
    367072 (Arhgef12)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    367072 (Arhgef12)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    367072 (Arhgef12)
   05152 Tuberculosis
    367072 (Arhgef12)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    367072 (Arhgef12)
Membrane trafficking [BR:rno04131]
 Others
  Rho GTPase associated proteins
   Rho guanine nucleotide exchange factors (GEFs)
    367072 (Arhgef12)
SSDB
Motif
Pfam: RGS-like PH_16 RhoGEF PDZ PDZ_6 PDZ_2 PH_13 Ribonuc_2-5A
Other DBs
NCBI-GeneID: 367072
NCBI-ProteinID: NP_001013264
RGD: 1305111
Ensembl: ENSRNOG00000008924
UniProt: Q5BMA6
Position
8
AA seq 1546 aa
MSGTQSTITDRFPLKKPIRHGSILNRESPTDKKQKVERSTSHDFDPTDSSSKKTKSSSEE
SRSEIYGLVQRCVIIQKDDNGFGLTVSGDNPVFVQSVKEDGAAMRAGVQTGDRIIKVNGT
LVTHSNHLEVVKLIRSGSYVALTVQGRPPGSPQIPLAESEVEPSVIGHMSPIMTSPHSPG
AAGNMERITSPVLMGEENNVVHNQKVEILRKMLQKEQERLQLLQEDYNRTATQRLLKEIQ
EAKKHIPQLQEQLSKATGSAQDGAVIAPSRPLGDALTLSEAETDPGDGLCRTDWSSGDAS
RPSSDSADSPKSSLKERVCLEDTPERTEGVQDADTQSLVGSPSTRGAPHIIGAEDDDFGT
EHEQINGQCSCFQSIELLKSRPAHLAVFLHHVVSQFDPATLLCYLYSDLYKQTNSKETRR
VFLEFHQFFLDRSAHLRVSVPEEISVDLEKRRPELIPEDLHRHYIQTMQERVHPEVQRHL
EDFRQKRSMGLTLAESELTKLDAERDKDRGTLEKERACAEQIVTKIEEVLMTAQAVEEER
SSTMQYVILMYMKYLGVKVKEPRNLEHKRGRIGFLPKIKQSMKKDREGEEKGKRRGFPSI
LGPPRRPSRHDNSAIGRAMEIQKLRHPKHLSAPSSMSPELQDPAKLRQSGVANEGTDTGY
LPASSMSSATSGAALSQEGGRENDTGAKQVGDAVAPGDCLDSIPRVPNTVFDFPPPLLDQ
VQEEECEVERVAEHGTPKPFRKFDSIAFGESQSEDEQFENDLETDPPNWQQLVSREVLLG
LKPSEIKRQEVINELFYTERAHVRTLKVLDQVFYQRVSREGILSPSELRKIFSNLEDILQ
LHVGLNEQMKAVRKRNETSVIDHIGEDLLLWFSGPGEEKLKHAAATFCSNQPFALEMIKS
RQKKDSRFQTFVQDAESNPLCRRLQLKDIIPTQMQRLTKYPLLLDNIAKYTEWPPEREKV
KKAADQCRQILNYVNQAVREAENKQRLEDYQRRLDTSSLKLSEYPNVDELRNLDLTKRKM
IHEGPLVWKVNRDKSIDLYTLLLEDILVLLQKQDDRLVLRCHSKILASTADSKHTFSPVI
KLSTVLVRQVATDNKALFVISMSDNGAQIYELVAQTVSEKTVWQDLICRMAASVKEQSTK
PIPLPQPPPCEGDNDEEEPAKLKVEHHDLSVAGLQSPDRVLGLESPLISSKPQSHSMNTP
GKSEAEAEHLFVTATQFAKEQHANGTFKEGDGGYPVTISDPHLPVSEERWALDALRNLGL
LKQLLVQQLGLTEKTTQEDWRSFSRYRPASEEAQADSGIPDLESVKACHAGEGQMSFKTG
TGDVATCDSPRTSTESCAVQDSVILASQDSQASNIIEMDHMLLTPEVPTTAEPEGGLDDS
GEHFFDAREAHSDDNPSEGDGAVRKEEEDVNVRISGNCLILDGYDAVQESSTDEEIASSF
TLQPVTGLPSVDSSHQQQHSPQNAISEGAISPSTPEFLVQRRWRAVDACSEVQSPSAWTD
SQSQILEYIHKIEADLEHLKKVEESYTLLCQRLAGSALPDKVSDKS
NT seq 4641 nt   +upstreamnt  +downstreamnt
atgagtggcacacagtctactatcacggacaggtttcccctcaaaaaacctataaggcat
ggaagtattttgaaccgagagtcaccaacagataagaaacagaaagtcgaacgcagcaca
tcacatgattttgaccccacagatagctcctccaagaagacaaagtctagttcagaggag
agtagatccgagatctatggtcttgttcagcgctgtgtgatcatccagaaagatgacaat
ggattcgggctgacagtcagcggggacaatccagtcttcgtacaatctgtcaaagaagat
ggagcagccatgcgcgctggagtacaaacaggtgatcgaatcatcaaggtgaatgggact
ctggtgactcattcaaatcatctggaggtggtgaaactaatcagatctggttcctatgta
gctctcactgtccagggacgcccacctgggtcgccccagattccacttgctgagtctgaa
gtagaaccatcagtcattggacatatgtctcccattatgacatcccctcattcccctgga
gcagccgggaacatggagagaatcactagtcctgtgctcatgggggaggaaaacaatgtg
gtccataaccagaaagtagagattctgaggaaaatgttacagaaagaacaggagcgtctg
cagttactgcaggaagattacaaccgaacggctacccagagattgctcaaggagatccag
gaggccaagaagcacatcccccagctgcaggagcagctgtccaaagccacaggctctgct
caggacggagctgtaattgcaccctccaggccattaggtgatgccctaacactcagcgag
gcagaaacggaccctggagacggcctgtgcaggactgactggagcagtggagatgcttct
cggcccagtagtgacagtgcagatagccccaagagtagcctgaaggaaagggtttgtctc
gaggacaccccagagaggactgaaggagttcaggatgctgacacacagtcgctggtcggc
agtccctccacccgtggcgcccctcatattatcggagcagaggatgatgattttggtact
gaacacgagcagatcaatggacagtgcagctgtttccagagcattgagttgctgaagtct
cgccctgcccacttggctgttttcttacaccatgtagtctcacagtttgaccctgcaaca
ttgctctgttatctctattcagacctgtataagcagacgaactccaaggagactcggcgg
gtcttcctggagtttcatcagttcttcttggaccgatctgcacacctgagagtttccgtc
cccgaggaaatctctgtggatctagaaaagagaagacccgagctcattcctgaggatctg
catcgccattacattcaaacaatgcaggagagggttcaccctgaagttcagaggcacttg
gaggattttcgacagaaacgcagcatgggactgaccttggctgagagtgagctgaccaaa
cttgatgcagagagagacaaggaccggggaactctggagaaggagcgagcatgtgcggaa
cagatcgttaccaaaattgaagaagtgttgatgactgctcaggctgtagaagaagaaagg
agttccacaatgcagtatgtaattctcatgtatatgaagtatttgggagtaaaagtgaaa
gaacctcgaaacttggagcacaagcggggtcggatcggcttccttccaaagatcaagcaa
agcatgaagaaagatagagagggcgaagaaaaagggaagcgaagaggattccccagcatt
ttgggacccccaaggagaccaagccgccacgacaacagtgcaattggcagggccatggag
atacagaagcttcgccacccgaagcacttgtccgcaccctcatctatgagtcctgagctt
caggaccctgctaagttgcgccagagtggagtagccaatgaaggaacagacactggatat
ctgcctgccagttccatgtcctctgccacctcaggggctgctctttcccaagagggaggg
agagagaatgacacaggagcaaaacaagttggagacgcggtggcacctggagactgcttg
gatagcatacctcgagtccccaatactgtttttgacttccccccgcctctgctagatcaa
gtgcaggaggaggaatgtgaagtggagagggtggcagaacatggaaccccaaaacccttt
cgaaagtttgacagcatcgcctttggagaaagtcagagtgaggacgagcagtttgaaaat
gacctggaaacagatccacccaactggcagcagctcgttagcagagaagtgctactggga
ctgaaaccctccgagatcaagagacaggaagtgattaatgaattgttctacactgagaga
gcgcatgtccgaacactgaaggttcttgaccaagtattctatcagcgagtgtccagggaa
gggattctatcaccttccgagctgcgcaagattttttcaaacttggaggatatccttcaa
cttcatgttgggttgaatgagcagatgaaagctgtccgaaaaaggaacgagacctcagtt
attgatcatattggggaagatctgctcctttggttcagtggaccaggggaggagaagctg
aagcacgctgctgccacattctgcagtaaccagcctttcgccctggaaatgatcaagtct
cgccagaaaaaggattctcgattccagacttttgtgcaagatgctgagagtaaccccctg
tgccgtcgtcttcagctgaaggatatcattcccacccaaatgcagaggctcaccaagtac
ccccttcttttggataatatcgccaaatacacagaatggcctccagaaagggaaaaggtg
aagaaggctgcagatcaatgtcgtcagatcttaaattatgtaaatcaggctgtcagggag
gcagaaaacaagcagcgcttagaagactatcagcgtcgccttgacacctccagtctcaag
ttgtctgagtacccgaatgttgatgagctcaggaatttggatttaacaaaaagaaagatg
attcatgaagggccgttggtctggaaggtgaatagagataaaagcatcgatctgtataca
ctgctgctggaagacattcttgtgctgttacagaagcaggacgacaggctggtactgagg
tgccacagcaagatcctggcctccacagctgacagcaagcacaccttcagtcctgtcatt
aagctcagcacagtgctggtccgacaggtggccacagataacaaagctttattcgtcatc
tccatgtcagataatggagcccaaatttatgaattggtagcacagacggtttctgaaaag
acggtctggcaagacctcatctgtcggatggccgcatcagtgaaggagcagtccacaaag
ccgattcccctcccacagccgccaccttgcgaaggagacaatgatgaagaagaaccagcc
aagttaaaagtggagcaccatgatctttctgtcgctggtctgcagagtccagacagagtt
ttgggattagaatctcccttaatttcgtcaaaacctcagtcccattcaatgaatacccct
ggcaaatcagaggcagaggcagaacatctctttgtgaccgcaacacagtttgcaaaggag
cagcatgcaaatgggaccttcaaggaaggtgatggcgggtatccagtcacaatctcagat
ccacacttgcccgtgtcagaggagcggtgggcattggacgcactgagaaatttgggcttg
ttgaagcagttgctggttcagcagttggggctcacggagaagactactcaggaagactgg
cggtccttctcaagatacagaccggcttctgaagaggcacaggcggacagtggcattccg
gacttggaaagtgttaaggcttgtcatgccggggaaggacagatgtcttttaaaactgga
actggtgatgttgcaacttgtgacagtccacggacttcaactgagtcctgtgctgtacag
gattcggtgatactggcttcccaagacagccaggcaagcaacatcatagaaatggaccac
atgctcctgaccccagaggtgcctactactgcagagccagaggggggtctggatgacagt
ggagagcacttttttgatgcccgtgaagcacatagcgatgataatccatctgaaggtgat
ggcgcagtcagaaaggaagaggaggatgttaatgtgcgcatctcaggaaactgtttgatc
cttgatggctatgatgcagtgcaggagagctccacagatgaggagattgcctcctcattc
accctgcagcctgtgacaggcctcccttctgtggactccagccaccagcagcaacactcc
cctcagaatgccatttccgagggggcgatttcaccatccaccccagaattcctggtccag
cgacgctggagagctgtggatgcttgctctgaggtccagagtccctctgcttggacagat
tcacaaagccaaatcctggagtacattcataaaatagaggctgacctggaacacttaaag
aaggtggaggaaagttacacccttctttgccaaaggctggctggctcagccctccccgac
aaggtctcagataaaagttag

KEGG   Rattus norvegicus (rat): 60323
Entry
60323             CDS       T01003                                 

Gene name
Arhgef1
Definition
(RefSeq) rho guanine nucleotide exchange factor 1
  KO
K12330  Rho guanine nucleotide exchange factor 1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04270  Vascular smooth muscle contraction
rno04611  Platelet activation
rno04810  Regulation of actin cytoskeleton
rno04928  Parathyroid hormone synthesis, secretion and action
rno05135  Yersinia infection
rno05163  Human cytomegalovirus infection
rno05200  Pathways in cancer
rno05205  Proteoglycans in cancer
rno05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    60323 (Arhgef1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    60323 (Arhgef1)
  09152 Endocrine system
   04928 Parathyroid hormone synthesis, secretion and action
    60323 (Arhgef1)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    60323 (Arhgef1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    60323 (Arhgef1)
   05205 Proteoglycans in cancer
    60323 (Arhgef1)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    60323 (Arhgef1)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    60323 (Arhgef1)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    60323 (Arhgef1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    60323 (Arhgef1)
Membrane trafficking [BR:rno04131]
 Others
  Rho GTPase associated proteins
   Rho guanine nucleotide exchange factors (GEFs)
    60323 (Arhgef1)
SSDB
Motif
Pfam: RGS-like PH_16 RhoGEF PH_13 AbiJ_NTD3
Other DBs
NCBI-GeneID: 60323
NCBI-ProteinID: NP_067726
RGD: 620951
Ensembl: ENSRNOG00000020130
UniProt: Q5BK37
Position
1
AA seq 919 aa
MGEVAGGAAPGPPRSGLVSIIIGAEDEDFENELEANPEDQNSQFQSLEQVKRRPAHLMAL
LQHVALQFEPGPLLCCLHADMLSSLGPKEAKKAFLDFYHSFLEKTAVLRVPVPPSVAFEL
DRTRPDLISEDVQRRFIQEVVQSQQAAVTRQLEDFRSKRLMGMTPWEQELSLLEPWIGKD
RGNYEARERHVAERLLSHLEEMQHTISTDEEKSAAVVTAISLYMRHLGVRTKSGDKKSGR
NFFRKKVMGNRRSDEPPKTKKGLSSILDPARWNRGEPSAPDCRHLKVEVDEKPGPADRKG
SLGISSRDRTVGTPGQDNPGVSLHPLSVDSLDSREPGVDTPQEPGDTPPQGPTSLEPLAP
PESTEDNGETESPEPGDDGEPGRSGLEQEPEEPPGWRELVPSDTLLGLPKNQVKRQEVIS
ELLVTEAAHVRMLRVLHDLFYQPMAEGGFFPLEELQNIFPSLDELIEVHSLFLDRLMKRR
QESGYLIEEIGDVLLARFDGAEGSWFQKISSRFCSRQSFALEQLKAKQRKEPRFCAFVQE
AESRPRCRRLQLKDMIPTEMQRLTKYPLLLQSIGQNTEEPAERAKVELAAECCREILHHV
NQAVRDMEDLLRLKDYQRRLDLTHLRQSNDPMLSEFKNLDITKKKLVHEGPLTWRLTKDK
AVEVHVLLLDDLLLLLQRQDERLLLKSHSRTLTPTPDGKTMLRPVLRLTSAMTREVATDH
KAFYVIFTWDQEAQIYELVAQTSSERKSWCALITETAGSLKVPAPASRPKPRPSPSSTRE
PLLSSSENGTGGTEAAPADARTERILNDLLPFCRPGPEGQLAATALQKVLSLKQILLSTE
EDSGAGPPRDGDGVPGGGAPGPTHTQEVEENLLSLEVVIKQLEELEEEFCRLRPFLSQLG
EILSPNLAAPERSAQTGLS
NT seq 2760 nt   +upstreamnt  +downstreamnt
atgggagaagtcgccggaggggcggccccagggcctccccggtctggcctggtgtccatc
atcatcggggctgaggatgaggactttgagaatgaactggaggcgaacccagaagatcaa
aacagccagttccagagcctggagcaagtgaagcgtcgcccagcccacctcatggccctc
ctgcaacacgtggccctgcagttcgagccaggaccactgctctgctgcctgcatgctgac
atgctaagctcactgggccccaaagaagccaagaaggccttcctcgatttctatcacagt
ttcctggagaagactgcggttctgcgggtgccggtccctcccagcgttgcttttgaactt
gatcgtactcggcctgatctcatctctgaggatgtccagaggcggttcatacaagaggtg
gtacagagccagcaggcagccgtgacccgtcagctagaggacttccgctccaaacggctc
atgggcatgacaccctgggagcaggaactgagcctgctagagccctggattgggaaagac
cggggcaactatgaggcccgggagcggcatgttgcagagcggctgctctcccacctagag
gaaatgcaacataccatctccacagatgaagaaaaaagtgctgctgtggtcactgcaatc
agcctgtatatgcgccaccttggggtccggaccaagagtggggacaagaagtcagggagg
aacttcttccggaaaaaggtgatggggaatcggcggtcagacgagccccccaagacaaag
aaagggctgagcagtatcctagatcctgcccgctggaaccggggagagccatctgctcca
gactgtcgacatctaaaggtcgaggttgatgagaagccaggccctgcagaccggaaggga
agcctgggtatttcatctcgggacaggactgttgggactcctgggcaggacaacccagga
gtctccctgcaccctctgtctgtagacagcctggattcccgggaaccaggtgtggatacc
ccgcaggagccaggagatacacccccacaaggccctacaagcctggagcccctggcaccc
ccagagagcacagaggacaatggcgagactgaaagccctgagcctggagatgatggagag
ccagggcggtcaggcctggaacaggaaccagaagaacctcctgggtggagggaactggtg
ccctcagacaccctgctcggcctgcccaagaaccaagtgaagcggcaagaggtcatcagt
gagctgctggtgacggaggcggctcacgtccgcatgctacgggtactacatgacctcttc
taccagcccatggcagaagggggcttcttccctctggaggaactgcagaacatctttccc
agcctggatgagctcatcgaggtgcactccctgttcctcgatcgcttgatgaagcggaga
caagagagtggctacctcattgaggagattggtgatgtgctactggcccggttcgatggt
gctgagggctcatggttccagaagatctcttcccgcttctgcagccgccagtcattcgct
ctagagcagctcaaagccaagcagcgcaaggagcctcgattctgtgcctttgtgcaggaa
gctgagagccgcccccgctgccggcggctgcagttgaaggacatgatccccactgagatg
cagcggctgaccaagtacccactgctgctgcagagtattgggcagaacacagaagagcct
gccgagcgggcaaaggtggaacttgcagctgagtgctgccgtgagattctgcaccacgtt
aatcaagctgtccgtgacatggaggacctgctgcggctcaaggattaccagcggcgcctg
gacttgactcacctgcggcagagcaatgacccaatgctgagcgagttcaagaacctggat
atcactaagaagaagttggtccatgaaggccccctcacgtggcgactaaccaaagacaaa
gctgtagaggtccacgtgctattgctggacgacctgctgctgctgctccagcgccaggat
gagaggctgctgctcaagtcacacagccggacgctgacacccacacccgacggcaagacc
atgctgcggcctgtgctccggctcacctctgccatgacccgggaggtggccactgatcac
aaagctttttacgtcatttttacctgggaccaggaggcccagatatatgagctggtggca
cagacatcgtcggaacgcaagagctggtgtgccctcatcacagagactgccggatccctg
aaggtccctgcccctgcctcccgccccaaaccccggcccagcccaagcagcacccgagaa
cccctgctcagcagctctgagaatggcactggaggcacagaggccgctccagctgatgcc
cggacagagcggatcctcaacgacctcctgcccttctgcagaccaggcccagagggccag
cttgctgccacagccctccagaaagtactgtccctgaaacagatcctgttgagcactgag
gaagacagtggagcagggcctccccgcgatggggatggggtgcctggtggtggtgcccca
ggcccaacacacacccaggaggttgaggaaaacctgttgagcctagaagtggtcatcaaa
caactggaggagttagaagaggaattttgtcgcctaagacccttcctgtctcagcttggg
gagattctgtcccccaacctggctgcacctgagcgctctgctcagacaggcctttcatga

KEGG   Rattus norvegicus (rat): 78966
Entry
78966             CDS       T01003                                 

Gene name
Arhgef11
Definition
(RefSeq) rho guanine nucleotide exchange factor 11
  KO
K12331  Rho guanine nucleotide exchange factor 11
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04270  Vascular smooth muscle contraction
rno04928  Parathyroid hormone synthesis, secretion and action
rno05163  Human cytomegalovirus infection
rno05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09152 Endocrine system
   04928 Parathyroid hormone synthesis, secretion and action
    78966 (Arhgef11)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    78966 (Arhgef11)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    78966 (Arhgef11)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    78966 (Arhgef11)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    78966 (Arhgef11)
Membrane trafficking [BR:rno04131]
 Others
  Rho GTPase associated proteins
   Rho guanine nucleotide exchange factors (GEFs)
    78966 (Arhgef11)
SSDB
Motif
Pfam: RGS-like PH_16 RhoGEF PDZ PDZ_6 PDZ_2 RGS
Other DBs
NCBI-GeneID: 78966
NCBI-ProteinID: NP_076472
RGD: 619705
Ensembl: ENSRNOG00000015026
UniProt: Q9ES67
Structure
PDB: 
3CX8 3CX7 3CX6

Position
2
AA seq 1527 aa
MSIRLPHSIDRSASKKQSHLSSPIASWLSSLSSLGDSTPERTSPSHHRQPSDTSETTAGL
VQRCVIIQKDQHGFGFTVSGDRIVLVQSVRPGGAAMKAGVKEGDRIIKVNGTMVTNSSHL
EVVKLIKSGAYAALTLLGSSPPSVGVSGLQQNPSVAGVLRVNPIIPPPPPPPPLPPPQHI
TGPKPLQDPEVQKHATQILWNMLRQEEEELQDILPPCGETSQRTCEGRLSVDSQEADSGL
DSGTERFPSISESLMNRNSVLSDPGLDSPQTSPVILARVAQHHRRQGSDAALLPLNHQGI
DQSPKPLIIGPEEDYDPGYFNNESDIIFQDLEKLKSHPAYLVVFLRYILSQADPGPLLFY
LCSEVYQQTNPKDSRSLGKDIWNIFLEKNAPLRVKIPEMLQAEIDLRLRNNEDPRNVLCE
AQEAVMLEIQEQINDYRSKRTLGLGSLYGENDLLGLDGDPLRERQMAEKQLAALGDILSK
YEEDRSAPMDFAVNTFMSHAGIRLRESRSSCTAEKTQSAPDKDKWLPFFPKTKKQSSNSK
KEKDALEDKKRNPILRYIGKPKSSSQSIKPGNVRNIIQHFENSHQYDVPEPGTQRLSTGS
FPEDLLESDSSRSEIRLGRSGSLKGREEMKRSRKAENVPRPRSDVDMDAAAEAARLHQSA
SSSASSLSTRSLENPTPPFTPKMGRRSIESPNLGFCTDVILPHLLEDDLGQLSDLEPEPE
VQNWQHTVGKDVVANLTQREIDRQEVINELFVTEASHLRTLRVLDLIFYQRMRKENLMPR
EELARLFPNLPELIEIHNSWCEAMKKLREEGPIIRDISDPMLARFDGPAREELQQVAAQF
CSYQSVALELIRTKQRKESRFQLFMQEAESHPQCRRLQLRDLIVSEMQRLTKYPLLLENI
IKHTEGGTSEHEKLCRARDQCREILKFVNEAVKQTENRHRLEGYQKRLDATALERASNPL
AAEFKSLDLTTRKMIHEGPLTWRISKDKTLDLQVLLLEDLVVLLQRQEERLLLKCHSKTA
VGSSDSKQTFSPVLKLNAVLIRSVATDKRAFFIICTSELGPPQIYELVALTSSDKNIWME
LLEEAVQNATKHPGAAPIPIHPSPPGSQEPAYQGSTSSRVEINDSEVYHTEKEPKKLPEG
PGPEQRVQDKQLIAQGEPVQEEDEEELRTLPRAPPSLDGENRGIRTRDPVLLALTGPLLM
EGLADAALEDVENLRHLILWSLLPGHTVKTQAAGEPEDDLTPTPSVVSITSHPWDPGSPG
QAPTISDSTRLARPEGSQPEGEDVAVSSLAHLPPRTRSSGVWDSPELDRNPAAEAASTEP
AASYKVVRKVSLLPGGGVGAAKVAGSNAIPDSGQSESELSEVEGGAQATGNCFYVSMPAG
PLDSSTEPTGTPPSPSQCHSLPAWPTEPQPYRGVRGGQCSSLVRRDVDVIFHTIEQLTIK
LHRLKDMELAHRELLKSLGGESSGGTTPVGSFHTEAARWTDYSLSPPAKEALASDSQNGQ
EQGSCPEEGSDIALEDSATDTAVSPGP
NT seq 4584 nt   +upstreamnt  +downstreamnt
atgagcatacgattgccccatagtatagacagatcagccagtaaaaagcagtctcacctg
tccagtcccattgcatcctggttaagtagcctgtcttctctgggagattctacacctgaa
cgcacatccccttctcaccaccgccagccctctgacacttctgagacaacagcaggtctt
gttcagcgctgtgtcatcatccaaaaggaccagcatggctttggcttcacagttagtgga
gatcgcattgtactggtgcagtccgtgcgccctggaggcgcagccatgaaagctggtgtg
aaagagggtgaccggatcatcaaagtaaacggcaccatggtgaccaatagctcacacctg
gaggtggtaaagcttatcaaatctggcgcctatgctgcgcttaccctcctaggctcttct
cctccctccgtcggcgtctctgggctccagcagaatccatctgtggcaggagtgctcaga
gttaaccccatcattcctccaccacctcccccgccacccttgccacctccacagcacatt
actggacccaaacctcttcaggatcctgaagtccaaaagcacgccactcaaatcctctgg
aatatgctaagacaggaggaggaagagttacaggacatacttccaccctgtggtgagacc
agtcagagaacatgtgagggccgcctctctgtggactcccaggaggcagacagtggcttg
gattctgggacagaacgctttccctccatcagtgagtcattgatgaatcggaactcagta
ttgtcagatcctggactagacagccctcaaacctcccctgtaatcctggccagggtggcc
cagcaccacaggcgacagggctcagatgcagcgttgctcccgctcaaccaccagggtata
gatcaaagcccaaagcctctgattattggcccagaggaagattatgacccaggttatttc
aacaatgagagtgacatcatcttccaagatcttgaaaaactgaagtcacatccagcttac
ttggtagtttttctacgttacatcctctctcaggcagaccctggccccctgcttttttat
ttgtgttcagaagtttatcaacagacaaatcccaaagattcccgaagtctggggaaagac
atctggaacattttcctggagaaaaatgcgcctctcagagtgaagatccctgagatgttg
caggctgaaattgacctacgcctgcggaacaatgaggaccctcgcaatgtgctctgtgaa
gctcaggaggcagtcatgctggaaatccaggagcagatcaacgactacagatccaagcgt
actctgggcctgggcagcctctatggtgaaaatgacctgctaggcctggatggggaccct
cttcgagaacgccaaatggctgagaagcagctggctgcccttggagatatcttgtccaaa
tatgaggaagatcggagtgcccccatggactttgctgttaatacctttatgagccacgct
gggatccgtcttcgggagtctcgatcctcctgcacggcagaaaagacccagtctgcccct
gacaaggacaagtggctgcccttcttccctaagaccaagaagcagagcagcaattccaag
aaagaaaaggatgccttggaggacaagaagcgaaaccccatcctcagatatattgggaag
cccaagagctcctctcagagcattaagccaggcaatgtgaggaacatcattcagcacttt
gagaacagccatcagtatgatgtcccagagccggggacacaacgactctcaacaggaagc
tttcctgaggacctgctggagagtgacagttcgcgctcagagattcgactgggccgctct
gggagcctcaagggccgggaagagatgaagcgatcccggaaagcagagaacgtgccccgg
cctcgaagtgacgttgacatggatgctgctgcagaggctgcccgccttcaccagtcagcc
tcgtcctctgcctccagcctctccaccaggtctcttgagaacccaacccctcccttcacc
cccaaaatgggccgcaggagcattgagtcccccaatctggggttctgtacagacgtcatc
cttccccacctcctggaggatgatctgggccaattgtctgacctggagccagagccagag
gtccaaaactggcagcatacagtaggcaaggatgtggtggccaacctgacccagagggaa
attgaccggcaagaggtcatcaatgagctttttgtgacagaagcatctcacctgcgcaca
ctccgagtcctggacctcatcttctaccagcgcatgagaaaggagaacctaatgcctcgg
gaagagctagcgcggctcttccctaacctgcctgagctcatagagattcacaattcctgg
tgtgaggccatgaagaagctccgggaggagggccccattatcagagacatcagtgacccc
atgctggctcggtttgatggtcctgcccgagaagaactccagcaagtagctgcacaattc
tgttcctatcagtcagtagccctagagctaatcaggactaagcaacgtaaggagagtcgg
ttccagctcttcatgcaggaggctgagagccaccctcagtgccggcgtctgcagctccga
gacctcatcgtctctgaaatgcaacggctcaccaagtacccactgctgctagagaacatc
atcaagcacacagagggtggcacctctgagcatgagaagctctgccgtgcccgggaccag
tgccgggagattctcaagtttgtgaatgaagcagtaaagcagacagagaaccgccaccgg
ctagaggggtaccagaaacgcctggatgccactgccctagagcgggccagcaaccccttg
gcagcagagttcaagagcctggatcttacaacaaggaagatgatccacgaggggcctctg
acctggaggatcagcaaagacaagaccctggacctccaggtgcttctgcttgaggacctg
gtggtactgctgcagagacaagaggagcggctgctgctaaagtgccacagcaagacagcc
gtgggctcctccgacagcaagcagacgttcagccctgtgctgaagctcaatgctgtgctc
atccgctccgtggctacagacaagcgagccttcttcatcatctgcacctccgagctgggc
cctccccagatctatgagctggttgcattgacgtcatcagacaagaatatatggatggag
ctcttagaagaggccgtgcagaatgccaccaagcaccctggagctgccccaatccccatc
catccctcaccaccaggatcccaggagccggcctaccagggctccacctccagcagggta
gaaataaatgactcagaagtatatcacactgaaaaagaacccaagaagctacctgaaggc
cccgggcctgagcagagagttcaagacaagcagctgatagcacaaggggagcctgtgcag
gaagaggatgaagaggaattgaggaccttgcctcgagctcccccctccctggatggagaa
aacagaggcatcaggacaagggaccctgtccttctggccctcacaggccctctgctcatg
gagggacttgctgatgctgccctggaagatgtggagaacttgcgtcacctgatcctgtgg
agcctgctgcctggtcacactgtgaagactcaggctgctggcgagcctgaggatgacctc
acacccaccccttctgtcgtgagcatcacctctcacccctgggacccagggtccccaggg
caagctcccaccataagtgacagcacccgacttgcgaggccagagggcagccagccagag
ggcgaggatgttgctgtcagttctctggcacacctgccgccaaggaccagaagttctggc
gtctgggactctcctgagctggataggaatccggctgcagaggctgcaagcacagaacca
gcagcaagttacaaggttgtgagaaaagtctctctactccctggtggtggtgtcggtgca
gccaaggtggcgggcagcaatgctatccctgacagtggccagtcagaatctgagctatct
gaagtggaaggcggagcacaggctacggggaactgtttctatgtcagcatgccagcagga
cctctggactccagcactgagcctactgggacacccccaagcccctcacagtgtcacagc
ctccctgcatggccaacagagcctcagccctacaggggagtccgtgggggtcagtgttcc
agcctggtccgcagggatgtggatgtgatcttccataccatcgagcagctcaccatcaag
cttcacagactgaaggacatggagctggcccacagagagctgctcaagtcccttggagga
gagtcatcgggtggaaccacacctgtggggagttttcacacagaggcagccagatggaca
gactactccctctctcctccagccaaggaagccctggcctctgattcccaaaatggtcag
gagcaggggtcctgccctgaagaaggctccgacatcgccctggaagacagtgccactgac
acagctgtgtcaccaggaccatag

DBGET integrated database retrieval system