KEGG   Rattus norvegicus (rat): 293049
Entry
293049            CDS       T01003                                 

Gene name
Rlbp1
Definition
(RefSeq) retinaldehyde binding protein 1
  KO
K19625  retinaldehyde-binding protein 1
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99985 Amino acid metabolism
    293049 (Rlbp1)
SSDB
Motif
Pfam: CRAL_TRIO CRAL_TRIO_2 CRAL_TRIO_N DUF1266
Other DBs
NCBI-GeneID: 293049
NCBI-ProteinID: NP_001099744
RGD: 1309649
Ensembl: ENSRNOG00000016897
UniProt: D3Z956
Position
1q31
AA seq 317 aa
MSEGVGTFRMVPEEEQELRAQLEQLTTKDHGPVFGPCSQLPRHTLQKAKDELNEREETRD
EAVRELQELVQAQAASGEELAVAVAERVQARDSAFLLRFIRARKFDVGRAYELLKGYVNF
RLQYPELFDSLSMEALRCTIEAGYPGVLSSRDKYGRVVMLFNIENWHCEEVTFDEILQAY
CFILEKLLENEETQINGFCIVENFKGFTMQQAAGLRPSDLKKMVDMLQDSFPARFKAIHF
IHQPWYFTTTYNVVKPFLKNKLLQRVFVHGDDLDGFFQEIDENILPADFGGTLPKYDGKV
VAEQLFGPRVEVENTAL
NT seq 954 nt   +upstreamnt  +downstreamnt
atgtcagagggggtgggcacattccgaatggtccctgaagaggagcaggagctccgggca
cagctagaacagctcacaaccaaggatcatggtcctgtctttggcccatgcagccagctg
ccccgccacactttgcagaaggctaaggatgagctgaatgaaagggaggaaacccgggat
gaggcggtgagggagctacaggagctggtccaggcacaggcagcttctggggaagagttg
gccgtggcagtggctgagagggtgcaggcaagagacagcgccttcctcctgcgcttcatc
cgtgcccgaaagtttgatgtgggccgggcttatgagctgctcaaaggctatgtgaacttc
cggctccagtaccctgaactcttcgatagcctatctatggaggctctccgctgcactatc
gaggccggttaccctggtgtcctttccagtcgggacaagtatggtcgagtggttatgctc
ttcaacattgaaaactggcactgtgaagaagtcacctttgatgagatcttacaggcatat
tgtttcattctggagaaactgctggagaacgaggaaacccaaatcaacggcttctgtatt
gtggagaacttcaagggcttcaccatgcagcaggccgcgggactccgcccctccgatctc
aagaagatggtggacatgctccaggattcattcccagccaggttcaaagctatccacttc
atccaccaaccatggtacttcaccaccacttacaatgtggtcaagcccttcttgaagaac
aagttgctacagagggtcttcgttcatggagatgacctggacggcttcttccaggagatt
gatgagaatatcttgcctgctgactttgggggtacactgcccaagtatgacggcaaagtt
gtcgctgagcagctcttcggtccccgggttgaggttgagaacacagccttgtga

DBGET integrated database retrieval system