KEGG   Rattus norvegicus (rat): 293056
Entry
293056            CDS       T01003                                 

Gene name
Cpeb1
Definition
(RefSeq) cytoplasmic polyadenylation element binding protein 1
  KO
K02602  cytoplasmic polyadenylation element-binding protein
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04114  Oocyte meiosis
rno04914  Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    293056 (Cpeb1)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    293056 (Cpeb1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:rno03019]
    293056 (Cpeb1)
Messenger RNA biogenesis [BR:rno03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     293056 (Cpeb1)
   Factors involved in mRNA localization
    Trans-acting binding proteins
     293056 (Cpeb1)
   mRNA cycle factors
    P-body specific factors
     293056 (Cpeb1)
SSDB
Motif
Pfam: CEBP1_N RRM_7 CEBP_ZZ RRM_1
Other DBs
NCBI-GeneID: 293056
NCBI-ProteinID: NP_001099746
RGD: 1310421
Ensembl: ENSRNOG00000019161
UniProt: P0C279
Position
1q31
AA seq 561 aa
MAFSLEEESGRIKDCWDNQEVPALSTCSNANIFRRINAILDDSLDFSKVCTTPINRGIHD
QLPDFQDSEEAITSRMLFPTSAQESPRGLPDANGLCLGLQSLSLTGWDRPWSTQDSDSSA
QSNTQSVLSMLQNPLGNVLGKTPLSFLSLDPLGSDLDKFPAPSVRGSRLDTRPILDSRSS
SPSDSDTSGFSSGSDHLSDLISSLRISPPLPFLSMTGNGPRDPLKMGVGSRMDQEQAALA
AVAPSPTSAPKRWPGTSVWPSWDLLGAPKDPFSIEREARLHRQAAAVNEATCTWSGQLPP
RNYKNPIYSCKVFLGGVPWDITEAGLVNTFRVFGSLSVEWPGKDGKHPRCPPKGNMPKGY
VYLVFELEKSVRALLQACSHDPLSPDGLSEYYFKMSSRRMRCKEVQVIPWVLADSNFVWS
PSQRLDPSRTVFVGALHGMLNAEALAAILNDLFGGVVYAGIDTDKHKYPIGSGRVTFNNQ
RSYLKAVTAAFVEIKTTKFTKKVQIDPYLEDSLCLICSSQPGPFFCRDQVCFKYFCRSCW
HWRHSMEGLRHHSPLMRNQKN
NT seq 1686 nt   +upstreamnt  +downstreamnt
atggctttttctctggaagaagaatcaggaaggataaaggactgctgggacaaccaagag
gttcctgcactctctacatgtagcaatgccaatatctttcgaaggataaatgccattttg
gatgattcactggacttcagtaaagtctgcacaacacctataaatcgaggaattcatgat
cagttgccagacttccaggactctgaagaagcaattacaagcaggatgcttttccccacc
tctgcgcaagaatctccccgcggcctcccagatgcaaacggtttgtgccttggcctgcag
tcactcagtctgactggctgggaccgaccctggagcacccaggactcagactcctcagcc
cagagcaacacacagtcagtattaagcatgctccaaaatccactgggaaatgtcttagga
aaaacccccttgagcttcctgtctctggatccccttgggtctgacttggacaagttccca
gcgccctcagttagaggatctcgcctggacacccggcctatcctggactcccgttctagc
agcccctctgactcagacacgagtggcttcagctctggatcagatcatctctcagatttg
atttcaagccttcgcatttcccctcctctgccctttctttctatgacgggaaatggtccc
agagaccctctaaagatgggagttgggtctcgaatggaccaagagcaagctgctcttgct
gcagttgctccctctccaaccagtgctccaaagagatggccaggaacttctgtgtggcca
tcttgggaccttctcggagctcctaaagacccattcagcatagagagagaggctagactc
cacaggcaggccgcagctgtgaatgaagctacatgtacctggagtggccagcttcctccc
cggaactacaagaaccccatctactcatgcaaggtgttcctaggaggtgttccttgggac
attacagaagctggattggttaacaccttccgtgtttttggctctctgagtgtggagtgg
cctggtaaggatggcaagcacccccggtgtcctcccaaaggtaatatgcctaaagggtat
gtgtatttggtgtttgaactagagaagtccgtccgggccttgcttcaggcttgttctcat
gacccactgagcccagatggcctaagtgaatattatttcaagatgtccagccgaaggatg
cgctgcaaagaagtacaggtaatcccttgggtcttggctgacagcaactttgtctggagc
ccatctcagaggctggatcccagcaggacggtgtttgttggtgccttgcacgggatgctc
aatgctgaggctctggctgccatcttgaatgacctatttggtggagtggtgtatgctggg
attgacacagataagcacaagtaccccattgggtctggtcgtgtgactttcaataaccaa
cgtagttacctgaaagcagtcactgctgcttttgtggagatcaaaaccaccaagtttacc
aagaaggttcagatcgacccctatctagaagattctctgtgtcttatctgcagttcacaa
cctggtcctttcttctgccgagatcaggtctgcttcaagtacttttgccgaagctgctgg
cactggcgacacagcatggaaggcctacgccaccacagcccgctaatgaggaaccagaag
aactaa

DBGET integrated database retrieval system