KEGG   Rattus norvegicus (rat): 293056
Entry
293056            CDS       T01003                                 

Gene name
Cpeb1
Definition
(RefSeq) cytoplasmic polyadenylation element-binding protein 1
  KO
K02602  cytoplasmic polyadenylation element-binding protein
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04114  Oocyte meiosis
rno04914  Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    293056 (Cpeb1)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    293056 (Cpeb1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:rno03019]
    293056 (Cpeb1)
Messenger RNA biogenesis [BR:rno03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     293056 (Cpeb1)
   Factors involved in mRNA localization
    Trans-acting binding proteins
     293056 (Cpeb1)
   mRNA cycle factors
    P-body specific factors
     293056 (Cpeb1)
SSDB
Motif
Pfam: CEBP1_N RRM_7 CEBP_ZZ RRM_1
Other DBs
NCBI-GeneID: 293056
NCBI-ProteinID: NP_001099746
RGD: 1310421
Ensembl: ENSRNOG00000019161
UniProt: P0C279
Position
1
AA seq 561 aa
MAFSLEEESGRIKDCWDNQEVPALSTCSNANIFRRINAILDDSLDFSKVCTTPINRGIHD
QLPDFQDSEEAITSRMLFPTSAQESPRGLPDANGLCLGLQSLSLTGWDRPWSTQDSDSSA
QSNTQSVLSMLQNPLGNVLGKTPLSFLSLDPLGSDLDKFPAPSVRGSRLDTRPILDSRSS
SPSDSDTSGFSSGSDHLSDLISSLRISPPLPFLSMTGNGPRDPLKMGVGSRMDQEQAALA
AVAPSPTSAPKRWPGTSVWPSWDLLGAPKDPFSIEREARLHRQAAAVNEATCTWSGQLPP
RNYKNPIYSCKVFLGGVPWDITEAGLVNTFRVFGSLSVEWPGKDGKHPRCPPKGNMPKGY
VYLVFELEKSVRALLQACSHDPLSPDGLSEYYFKMSSRRMRCKEVQVIPWVLADSNFVWS
PSQRLDPSRTVFVGALHGMLNAEALAAILNDLFGGVVYAGIDTDKHKYPIGSGRVTFNNQ
RSYLKAVTAAFVEIKTTKFTKKVQIDPYLEDSLCLICSSQPGPFFCRDQVCFKYFCRSCW
HWRHSMEGLRHHSPLMRNQKN
NT seq 1686 nt   +upstreamnt  +downstreamnt
atggctttttctctggaagaagaatcaggaaggataaaggactgctgggacaaccaagag
gttcctgcactctctacatgtagcaatgccaatatctttcgaaggataaatgccattttg
gatgattcactggacttcagtaaagtctgcacaacacctataaatcgaggaattcatgat
cagttgccagacttccaggactctgaagaagcaattacaagcaggatgcttttccccacc
tctgcgcaagaatctccccgcggcctcccagatgcaaacggtttgtgccttggcctgcag
tcactcagtctgactggctgggaccgaccctggagcacccaggactcagactcctcagcc
cagagcaacacacagtcagtattaagcatgctccaaaatccactgggaaatgtcttagga
aaaacccccttgagcttcctgtctctggatccccttgggtctgacttggacaagttccca
gcgccctcagttagaggatctcgcctggacacccggcctatcctggactcccgttctagc
agcccctctgactcagacacgagtggcttcagctctggatcagatcatctctcagatttg
atttcaagccttcgcatttcccctcctctgccctttctttctatgacgggaaatggtccc
agagaccctctaaagatgggagttgggtctcgaatggaccaagagcaagctgctcttgct
gcagttgctccctctccaaccagtgctccaaagagatggccaggaacttctgtgtggcca
tcttgggaccttctcggagctcctaaagacccattcagcatagagagagaggctagactc
cacaggcaggccgcagctgtgaatgaagctacatgtacctggagtggccagcttcctccc
cggaactacaagaaccccatctactcatgcaaggtgttcctaggaggtgttccttgggac
attacagaagctggattggttaacaccttccgtgtttttggctctctgagtgtggagtgg
cctggtaaggatggcaagcacccccggtgtcctcccaaaggtaatatgcctaaagggtat
gtgtatttggtgtttgaactagagaagtccgtccgggccttgcttcaggcttgttctcat
gacccactgagcccagatggcctaagtgaatattatttcaagatgtccagccgaaggatg
cgctgcaaagaagtacaggtaatcccttgggtcttggctgacagcaactttgtctggagc
ccatctcagaggctggatcccagcaggacggtgtttgttggtgccttgcacgggatgctc
aatgctgaggctctggctgccatcttgaatgacctatttggtggagtggtgtatgctggg
attgacacagataagcacaagtaccccattgggtctggtcgtgtgactttcaataaccaa
cgtagttacctgaaagcagtcactgctgcttttgtggagatcaaaaccaccaagtttacc
aagaaggttcagatcgacccctatctagaagattctctgtgtcttatctgcagttcacaa
cctggtcctttcttctgccgagatcaggtctgcttcaagtacttttgccgaagctgctgg
cactggcgacacagcatggaaggcctacgccaccacagcccgctaatgaggaaccagaag
aactaa

KEGG   Rattus norvegicus (rat): 303010
Entry
303010            CDS       T01003                                 

Gene name
Cpeb4
Definition
(RefSeq) cytoplasmic polyadenylation element-binding protein 4
  KO
K02602  cytoplasmic polyadenylation element-binding protein
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04114  Oocyte meiosis
rno04914  Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    303010 (Cpeb4)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    303010 (Cpeb4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:rno03019]
    303010 (Cpeb4)
Messenger RNA biogenesis [BR:rno03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     303010 (Cpeb4)
   Factors involved in mRNA localization
    Trans-acting binding proteins
     303010 (Cpeb4)
   mRNA cycle factors
    P-body specific factors
     303010 (Cpeb4)
SSDB
Motif
Pfam: RRM_7 CEBP_ZZ RRM_1 zf-U1
Other DBs
NCBI-GeneID: 303010
NCBI-ProteinID: NP_001100462
RGD: 1311931
Ensembl: ENSRNOG00000033169
UniProt: D3ZKL3
Position
10
AA seq 721 aa
MGDYGFGVLVQSNTGNKSAFPVRFHPHLQPPHHHQNATPNPAAFINNNTAANGSSAGSAW
LFPAPATHNIQDEILGSEKAKSQQQEQQDPLEKQQLSPSPGQEAGILPETEKAKAEENPG
DNSSENSNGKEKIRIESPVLTGFDYQEATGLGTSTQPLTSSASSLTGFSNWSAAIAPSSS
TIINEDASFFHQGGVPGASANNGALLFQNFPHHVSPGFGGSFSPQIGPLSQHHPHHPHFQ
HHHSQHQQQRRSPASPHPPPFTHRNAAFNQLPHLANNLNKPPSPWSSYQSPSPTPSSSWS
PGGGGYGGWGASQGRDHRRGLNGGITPLNSISPLKKNFASNHIQLQKYARPSSAFAPKSW
MEDSLNRADNIFPFPDRPRTFDMHSLESSLIDIMRAENDSIKGRLNYSYPGSDSSLLING
QSSLFPMEDGFLDDGRGDQPLHSGLGSPHCFTHQNGERVERYSRKVFVGGLPPDIDEDEI
TASFRRFGPLIVDWPHKAESKSYFPPKGYAFLLFQDESSVQALIDACIEEDGKLYLCVSS
PTIKDKPVQIRPWNLSDSDFVMDGSQPLDPRKTIFVGGVPRPLRAVELAMIMDRLYGGVC
YAGIDTDPELKYPKGAGRVAFSNQQSYIAAISARFVQLQHGEIDKRVEVKPYVLDDQLCD
ECQGARCGGKFAPFFCANVTCLQYYCEYCWAAIHSRAGREFHKPLVKEGGDRPRHISFRW
N
NT seq 2166 nt   +upstreamnt  +downstreamnt
atgggggattacgggtttggagtgctagtgcaaagcaatactgggaataaatctgctttt
ccagtccgattccatccacatctgcagcctccacaccatcaccaaaatgccacccccaac
cctgctgcttttataaataataacacagctgccaacggcagcagtgctgggtcagcttgg
ctctttcctgctccggctacccataacattcaggatgagatcttggggtcagaaaaagca
aaaagtcaacagcaggaacaacaagaccctttagaaaagcaacaactgtccccgagtcca
gggcaggaagctggaatactgcctgaaactgaaaaggcaaaagccgaagaaaatccaggg
gacaattcttcagagaacagcaacggaaaagaaaagatacgcattgaatcaccagtgttg
acaggattcgattaccaagaagccacaggcctcgggacttccacccaacccttgacatcc
agtgcatcatcccttactggtttcagtaactggtcagcagcgatagcgccttcttcctcc
acgataatcaatgaagatgcaagtttctttcaccagggaggggtccctggcgcttcagct
aataatggtgctctcttgtttcaaaatttcccccatcatgtcagccctggctttggtggt
agcttctcccctcagatcgggcctctctcccagcaccatcctcatcacccccatttccag
caccatcacagccagcatcagcagcagaggaggtctcctgccagtccccaccccccacct
ttcacacatagaaatgctgcttttaaccagctgcctcatttggcgaataatcttaacaaa
cctccttctccatggagtagctaccagagtccctctccaaccccctcttcttcctggagc
ccgggaggtggcggctatggtggctggggagcttctcaaggccgagatcaccgcagaggg
ctgaacggtggaataacacccctgaactccatctcacctttgaagaaaaattttgcaagc
aatcatattcagctccagaagtatgctcgccctagctcagcctttgctccaaaatcctgg
atggaagatagcttgaacagagctgacaacatttttccttttccggatcgccccaggaca
tttgacatgcactcattggagagctcactcattgacataatgagagctgaaaatgattcc
attaaaggtcgtctaaactattcatacccaggatccgatagttctctgcttattaatggt
cagtcttcattgttcccgatggaggatgggttcctggatgatggccgtggggaccagcct
cttcacagtggtctgggctcgcctcactgcttcactcaccaaaacggggagagagtggaa
cggtattcccgcaaggtgttcgtgggtggattgcctcctgacattgacgaagatgagatc
acggctagtttccgtcgctttggccctttgattgtggattggcctcataaagcagagagc
aaatcttatttcccaccaaaaggctatgccttcctgctgtttcaagatgaaagttctgtc
caggctctcattgatgcgtgcattgaagaagatggaaaactgtacctgtgtgtgtcaagt
ccaaccatcaaggataaaccagtgcagatccggccctggaatctcagtgacagtgacttt
gtgatggatggctcacagccacttgacccacggaaaacgatatttgttggtggtgttcct
cgaccattacgagctgtggagcttgcaatgataatggaccggctgtatggaggcgtctgc
tatgctggaatcgatactgacccagagctcaaatacccaaaaggagctggacgagtagcg
ttttctaatcaacagagttacatagctgctatcagtgctcgctttgttcagctgcagcat
ggagagatagataaacgggtggaggttaagccatatgtcttggacgaccagctgtgtgat
gaatgtcagggggcccgttgcggggggaaatttgctccatttttctgtgctaatgttacc
tgtctgcagtattactgtgaatattgctgggctgctattcactctcgtgctggcagagaa
ttccacaagcccctggtgaaggaaggtggcgaccgccctcggcatatctcattccgctgg
aactga

KEGG   Rattus norvegicus (rat): 309510
Entry
309510            CDS       T01003                                 

Gene name
Cpeb3
Definition
(RefSeq) cytoplasmic polyadenylation element-binding protein 3 isoform X2
  KO
K02602  cytoplasmic polyadenylation element-binding protein
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04114  Oocyte meiosis
rno04914  Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    309510 (Cpeb3)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    309510 (Cpeb3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:rno03019]
    309510 (Cpeb3)
Messenger RNA biogenesis [BR:rno03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     309510 (Cpeb3)
   Factors involved in mRNA localization
    Trans-acting binding proteins
     309510 (Cpeb3)
   mRNA cycle factors
    P-body specific factors
     309510 (Cpeb3)
SSDB
Motif
Pfam: RRM_7 CEBP_ZZ RRM_1 Ctr zf-U1 DUF4834 Coilin_N zf-B_box Baculo_PP31 Peroxin-13_N
Other DBs
NCBI-GeneID: 309510
NCBI-ProteinID: XP_008758601
RGD: 1564670
Ensembl: ENSRNOG00000020689
Position
1
AA seq 771 aa
MPTLLTVVKVLFQSGHIINPKEEINTIHFFSILSIFKNWTLKAAQTMQDDLLMDKSKTQP
QSQQQQQQQQQQQQQQQQQQQQRQQQQQQQQQLQPEPGAAEAPSTPLSSETPKPEDSSAV
PALSPASAPPAPNGPDKMQMESPLLPGLSFHQPPQQPPPPQEPAAPGASLSPSFGSTWST
GTTNAVEDSFFQGITPVNGTMLFQNFPHHVNPVFGGTFSPQIGLAQTQHHQQPPPPAPQP
PQPAQPPQAQPSQQRRSPASPSQAPYAQRSAAAYGHQPIMTSKPSSSSAAAAAAAAAAAS
SASSSWNTHQSVNAAWSAPSNPWGGLQAGRDPRRAVGVGVGVGVGVPSPLNPISPLKKPF
SSNVIAPPKFPRAAPLTSKSWMEDNAFRTDNGNNLLPFQDRSRPYDTFNLHSLENSLMDM
IRTDHEPLKGKHYPPSGPPMSFADIMWRNHFAGRMGINFHHPGTDNIMALNSRSSLFPFE
DAFLDDSHGDQALSSGLSSPTRCQNGERVERYSRKVFVGGLPPDIDEDEITASFRRFGPL
VVDWPHKAESKSYFPPKGYAFLLFQEESSVQALIDACLEEDGKLYLCVSSPTIKDKPVQI
RPWNLSDSDFVMDGSQPLDPRKTIFVGGVPRPLRAVELAMIMDRLYGGVCYAGIDTDPEL
KYPKGAGRVAFSNQQSYIAAISARFVQLQHNDIDKRVEVKPYVLDDQMCDECQGTRCGGK
FAPFFCANVTCLQYYCEYCWASIHSRAGREFHKPLVKEGGDRPRQVPFRWS
NT seq 2316 nt   +upstreamnt  +downstreamnt
atgcccactcttcttacagttgtcaaagtgcttttccagagcggtcacataatcaacccg
aaagaagaaataaatactattcattttttttcaattttatcgatctttaaaaactggaca
cttaaagctgcgcaaaccatgcaggatgatttactgatggacaaaagcaaaacccagccc
cagtctcagcagcagcagcagcagcagcagcagcagcagcagcagcagcagcagcagcag
cagcagcggcagcagcagcagcagcagcagcaacagctccagcccgagcccggcgcagcc
gaagccccgtccacgcccctctcctcagagacccccaagcctgaagacagtagcgcagtg
ccggccctcagccccgcctcggctccgccagcccccaacggccccgacaagatgcagatg
gagtcgccgctcctgccgggcttgagtttccatcagccccctcagcagccgccgccgccg
caggagcccgcggcacccggagcgtcgctgtcgccgtccttcggcagcacctggtcaacg
ggcactacgaacgcggtggaggacagcttcttccaggggatcaccccagtcaacgggacc
atgctcttccaaaacttcccgcaccacgtcaacccggtcttcggaggcaccttctcgccg
cagatcggcctggcgcagacccagcaccatcagcagccgccgccgcccgcgccacagccg
ccgcagcctgcgcagcccccgcaggcgcagccctcgcagcaacgccgctctcccgccagc
cccagccaggcgccctatgcgcagaggagcgccgccgcttatggccaccagcccatcatg
accagcaagccgtcttcatcctcggccgccgcggctgctgcggcagcggccgccgcctct
tcggcctcgtccagctggaacacgcaccaaagcgtgaacgccgcctggagtgctccgtcc
aacccgtggggtggcctgcaggcgggccgagaccctcgccgcgcggtcggcgtgggcgtg
ggcgtaggtgtgggggtaccatccccgcttaaccccatctcgccgctcaaaaagcccttc
tccagcaatgtgatcgctccacccaagttccctcgtgcagccccgctcacctccaagtct
tggatggaggataacgctttccggaccgataatggtaacaatctgttgccttttcaggac
cggagtaggccctatgacacttttaacttgcactccttggagaactccttaatggatatg
atcaggactgatcatgagcctctgaaaggtaaacactaccctcccagtggcccaccaatg
agtttcgctgatataatgtggaggaatcattttgcaggacgcatgggaataaacttccat
catccaggaacagataacattatggcccttaacagtcgatcttctctctttccctttgaa
gacgccttcttggatgacagccatggtgatcaggccttatcatctggcttaagttctccc
actcgatgtcaaaatggggaacgagtggaacgctactctagaaaagtgtttgttggaggt
cttcctcctgacatcgatgaagatgagatcactgccagctttcgcaggtttggacctctt
gtggtggactggcctcataaagcggagagcaagtcgtacttccctcctaaaggctacgcc
ttcctgctgttccaggaggagagctcggtgcaagcgttgatagacgcctgcctagaggag
gatgggaaactgtacttgtgtgtgtccagccccaccatcaaggataaaccggtgcaaatc
cgaccgtggaacctaagtgacagtgactttgtaatggatggctctcagcctttggacccc
agaaaaactatctttgttgggggagttccacgaccccttcgagctgttgaactggcaatg
ataatggaccgtttgtacggtggtgtttgctatgctggcattgatacagacccagagctg
aagtacccgaaaggtgctgggcgtgttgcgttctccaatcagcagagctacattgcagcc
atcagcgcgcgctttgtacagcttcaacacaacgacattgacaaacgggtggaggtgaag
ccgtacgtgctggatgatcagatgtgtgacgagtgtcagggcacacgctgcggtgggaag
ttcgccccgtttttctgtgccaacgtcacctgtctgcagtactactgtgaatactgctgg
gccagcatccactcccgagccggccgtgagttccacaaaccactggtgaaggagggaggc
gaccgccctcggcaggtcccattccgctggagctga

KEGG   Rattus norvegicus (rat): 360949
Entry
360949            CDS       T01003                                 

Gene name
Cpeb2
Definition
(RefSeq) cytoplasmic polyadenylation element-binding protein 2 isoform X1
  KO
K02602  cytoplasmic polyadenylation element-binding protein
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04114  Oocyte meiosis
rno04914  Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    360949 (Cpeb2)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    360949 (Cpeb2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:rno03019]
    360949 (Cpeb2)
Messenger RNA biogenesis [BR:rno03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     360949 (Cpeb2)
   Factors involved in mRNA localization
    Trans-acting binding proteins
     360949 (Cpeb2)
   mRNA cycle factors
    P-body specific factors
     360949 (Cpeb2)
SSDB
Motif
Pfam: RRM_7 CEBP_ZZ RRM_1
Other DBs
NCBI-GeneID: 360949
NCBI-ProteinID: XP_038948724
RGD: 1307485
Position
14
AA seq 1039 aa
MRDFGFGVLHTALLRSGSPRSSPGGSAYRPFAAGPSATPFGPLSPPPLPVTGFSEAASPF
AIPSGGGAASSAAASSSSPLVAHQQAVQDELLLGLTQQPARPLSGAAAAEQLPSHHPGGG
TNAGVTHLLPSQDFKPSLHHPSSSSASSCCCCRTSSPQDFSKRQQQQLSSQKRKELSPPH
RPHPPDAKPTPPPLHCPGRFSPPPPTPPPPPGPLLQSAPLAQRPQPFSLPHTQHLPPQDF
APRQRPADLPQLPQLPPSPPAAPRRRHGGAGSPRQTPVAGEGSAAEPPNAGLPPSTPPVN
PAPGSMESPNHPLLNSPSTLLPGAALGTSAFSSLQSPDLPHPGGGGGGGPPGGGGGGGSA
SPPPLPGFGTPWSVQTASPPPPQPPPAPQQQPSQQQQPPQQPPQPQPPGSSAATPGGGGG
AGGSLSAMPPPSPDSENGFYPGLPSSMNPAFFPSFSPVSPHGCAGLSVPAGGGGGGGGFG
GPFSAPAVPAPPAMNLPQQQPPPAAPQQPQSRRSPVSPQLQQQHQAAAAAFLQQRNSYNH
HQPLLKQSPWSNHQSSGWGTASMSWGAMHGRDHRRSGNMGIPGTMNQISPLKKPFSGNVI
APPKFTRSTPSLTPKSWIEDNVFRTDNNSNTLLPLQVRMVRSSLQLPAWGSDSLQDSWCT
AAGTSRIDQDRSRMYDSLNMHSLENSLIDIMRAEHDPLKGRLSYPHPGTDNLLMLNGWVP
GAELKSCGLHARSYGRRRGRSSLFPIDDSLLDDGHSDQVGVLNSPTCYSAHQNGERIERF
SRKVFVGGLPPDIDEDEITASFRRFGPLVVDWPHKAESKSYFPPKGYAFLLFQEESSVQA
LIDACIEEDGKLYLCVSSPTIKDKPVQIRPWNLSDSDFVMDGSQPLDPRKTIFVGGVPRP
LRAVELAMIMDRLYGGVCYAGIDTDPELKYPKGAGRVAFSNQQSYIAAISARFVQLQHGD
IDKRVEVKPYVLDDQMCDECQGARCGGKFAPFFCANVTCLQYYCEFCWANIHSRAGREFH
KPLVKEGADRPRQIHFRWN
NT seq 3120 nt   +upstreamnt  +downstreamnt
atgcgggacttcgggttcggggtgctgcacactgccctgctgcgcagcggcagcccccgg
tcctcgcccggcggcagcgcctaccggcccttcgccgccgggccgtccgccacgcccttc
ggcccgctgtcgccgccgccgttgcctgtcaccggcttctccgaggccgcctcccccttc
gccatcccctcgggcggcggcgcggccagctcagccgcagcttcctcttcctccccgctc
gtggcgcatcagcaggccgtgcaggatgagctgctgctcgggctgacacagcagccggcg
aggccgctctcgggggcggcggccgcagagcagctccccagccaccaccccggcggcggc
acgaacgcgggtgtgacccacctcctcccctcccaggacttcaaaccgagtctgcaccac
ccctcctcctcctccgcctcctcctgctgctgctgccgcacctcctccccgcaggacttc
agtaagcggcagcagcagcagctgagcagccagaagaggaaagagttgagtccgccacac
cgtccccaccctccggacgcgaagccgacgccgccgccgctccactgccccggccgcttc
agcccgccgccgccaacgccgccgccaccacccgggccgctcctgcagtcggcgccgctc
gcccagcgcccgcagccgttcagcctcccgcacacgcagcacctcccgccgcaggacttc
gccccgcggcagcgcccggccgacctgccccagctcccgcagctcccgccctcgccgccc
gcagctccgcggcgccgccacggaggcgcgggaagccctcgccagaccccggtcgcgggc
gagggcagcgccgccgagccccccaatgcgggcttgcccccctcgacgccgccggtgaac
cccgcgccgggctccatggagtcgcccaaccaccctctgctcaacagtcccagcaccctc
ctgcccggcgcggcgctcggcaccagcgccttcagcagcctgcagagcccggacctgccg
caccccggcggcggcgggggcgggggaccccccggaggcggagggggaggcggctccgcg
tctccgccaccgctgcccggcttcggcaccccctggtccgtgcagaccgcgtcgccgccg
ccgccccagcctccgccggcgccccagcagcagccatcccagcagcagcagccgcctcag
cagccgccgcagccacagcccccgggctcctccgctgccaccccgggcggcggcggcggc
gcgggcggctctctgagcgccatgccgccgcccagcccggactcggagaacggcttctac
cccgggctgccgtcgtccatgaacccggccttcttcccgagcttctcgccggtgtcgccg
cacggctgcgcggggctcagcgtgccggccggcggtggcggcggtggcggcggcttcggc
ggcccgttctctgctcccgcggtgcccgcgccgcccgccatgaatttacctcaacagcag
ccgccgccggcagcgccgcagcagccgcagagccggaggtcacccgtcagcccgcagctg
cagcagcagcaccaggcagccgcagccgccttcctgcagcagaggaactcgtacaaccac
caccagcctcttctgaaacaatctccttggagcaaccatcagagcagtggttggggcact
gcaagcatgtcctggggagcaatgcatggcagagatcaccgtagaagcggaaacatggga
attccagggactatgaatcagatatctccgttgaagaaaccgttttcgggtaatgttata
gcaccaccgaaattcactcgctctactccatcactgactccaaaatcttggattgaagat
aatgtgttcaggacagacaacaatagtaacacactcttacccttacaggtaagaatggtg
agatctagtttgcagttgccagcttggggctcagattcactccaagatagttggtgcact
gcagccggaacatccagaatagaccaggatcgaagtaggatgtatgatagcttgaatatg
cactctctggaaaattcccttattgatatcatgagagcagagcacgatcctctcaagggt
cgtttgagctatcctcatccaggaaccgacaatctgttaatgttaaatggttgggttcct
ggggctgaactcaagtcctgtggcttgcatgcaaggagttatgggcgaagacgaggtcga
tcttccctatttccaatagatgatagcttgttggatgatggtcacagtgatcaagttggt
gtgttaaattcaccaacatgttattcagctcatcaaaatggagaacgaatagaacgcttc
tctcgaaaagtttttgttggagggcttcctccagatattgatgaagatgagatcactgcc
agcttccggagatttggacctttggtagtagattggccccataaagcagaaagcaagtcc
tatttcccaccaaaaggctacgccttcctcctctttcaagaggagagctcggttcaggca
ctcattgacgcttgcattgaagaagatgggaagctctacctgtgtgtctccagccctact
atcaaagacaaacctgttcaaatccgtccttggaatttaagtgatagtgattttgtcatg
gatggttctcagcctttggatccccgaaaaacaatttttgttggaggtgttcctaggcca
ttaagggctgtggaacttgctatgatcatggaccggctgtatggtggtgtgtgttacgca
ggaatcgatacagatccagaactcaaatacccgaaaggtgctgggcgagtggctttctcc
aatcagcagagctacattgctgccatcagtgctcggtttgttcagcttcagcatggtgac
attgataaacgcgtggaggtgaagccatatgtgctagatgaccagatgtgtgacgagtgc
cagggtgcgcgctgcggtgggaaatttgccccctttttctgtgccaatgtcacctgcctg
cagtattactgtgagttttgttgggcaaatatccactctcgtgcgggacgcgagttccat
aagccattggtgaaggaaggtgctgatcgcccgcgtcagatccacttccgctggaactaa

DBGET integrated database retrieval system