KEGG   Rattus norvegicus (rat): 293057
Entry
293057            CDS       T01003                                 

Gene name
Whamm, RGD1563506, Whdc1
Definition
(RefSeq) WAS protein homolog associated with actin, golgi membranes and microtubules
  KO
K20479  WASP homolog-associated protein with actin, membranes and microtubules
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04530  Tight junction
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    293057 (Whamm)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    293057 (Whamm)
Membrane trafficking [BR:rno04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Others
   Others
    293057 (Whamm)
 Others
  Actin-binding proteins
   Nucleation-promoting factors (NPFs)
    293057 (Whamm)
SSDB
Motif
Pfam: JMY WHAMM-JMY_N WH2 ZnuA PhaP_Bmeg
Other DBs
NCBI-GeneID: 293057
NCBI-ProteinID: NP_001124200
RGD: 1563506
Ensembl: ENSRNOG00000028113
UniProt: D3ZKN4
Position
1q31
AA seq 797 aa
MDSEQPDSLEGWVPLREDLFPEPERHQLRFLVAWNAAEGQFAVTCHDRTAQRRRRGRQEA
GDGGCSWAGALSAAGFRGAHRQLAALWPALERCFPPLPPELDAASGAGWGLGRGLWALVW
ALVWPAPANPGDAALQDLCRQLEHYLGLAADGCGGATVRDVLFPAPGDSADCEGLSEFRE
RMLRARLDQTVARLRQLLQDHRKANTMVTLMKVYQEEDEVYQELVTMATTFFQYLLQPFR
DMREVATSCKLGILKSLEEDELGPKRVAALQKEASEWTRRAEEAVVSIQDITVNYFKETV
TALTGMQKQMEQDQRRFGQAAWATAMPRLENLKLMLARETLQLMRAKELCLKHRQAEIQR
KVEDLPDQGKNVGVVDELEIQYYETQLELYDVKLEILRNEETILVTRLDSVKRLIAEKQA
EVVYYDPCESPEELKSLAPDLELHLGDNRELRALSQQCQQLEAQRGRICSRRAQLRNRKD
HCRENHQLRLQQAKQNVRHFHHHHSIQMKRDKIKEEEQKKKEWIDHERQKTLERLRAYRE
KGPAPRSALKTSCSESMLSNLSGGCSQKRLSTAQHKTAAHPASSKTRSASPLPEATVKPP
EHQDPCGSAPGLALAPVSDQTLSGSSEEMSLAPPPPPPPPPPLPPPPLLPPSALPSFQGT
THQNIGFQTLATEDQPFPLACDMSARRPGGSDCQEGFQRPGSMDEVLASLRQGRTSLRKV
EMTTRPPPRTSVNEQVLAAIRQGVQLKKVHTGPNVDPSKKSTSDLERSIREALERIKKVS
ADSEEDNDEQSPVEWDR
NT seq 2394 nt   +upstreamnt  +downstreamnt
atggacagcgagcagcccgacagcctggagggctgggtgccgctgcgcgaggacctcttc
ccggagcccgagcgccatcagctgcgtttcctggtggcctggaacgccgccgagggccag
ttcgccgtcacctgtcacgaccgcacggcgcagcggcgccggcgcgggcgacaggaggcc
ggcgacgggggctgcagctgggccggggcgctgtcggcggccgggttccgcggcgcgcac
cggcagctggcggcgctgtggccggccctggagcgctgctttccgccgctgccgccggag
ctggacgcggcgagcggcgcgggctggggcctggggcgcgggctgtgggcgctcgtgtgg
gcgctcgtgtggccggcgcctgcgaaccctggcgacgcggcgctgcaggacctgtgccga
cagctggagcactacctgggcctggcggccgacggctgcggcggcgccaccgtgcgcgac
gtgctcttcccggccccgggtgactcggcagactgcgagggcctgagcgagttccgcgag
aggatgctgcgcgcgcgcctggaccagacggtcgcgcgactgcgccagcttcttcaagat
cacagaaaagccaacaccatggtaacattaatgaaagtttatcaagaggaagatgaagtc
tatcaagaactagttaccatggcaaccacattcttccagtatttactacagccatttaga
gacatgcgagaagttgcaacctcatgtaagcttggtattttgaagtccctggaagaggat
gagctgggtcctaaaagggtggctgccctacagaaggaagccagtgagtggaccagacgg
gctgaagaagcagtggtctctatccaggacatcactgtgaattattttaaggaaacagta
acagcattaacaggaatgcagaagcaaatggagcaggatcagaggagatttggccaggct
gcctgggccacagccatgcccaggctagaaaacctcaagctcatgttagctcgggagact
ctgcagcttatgagagccaaagagctgtgtctaaaacacagacaggctgaaatccagagg
aaggtggaagatcttccagaccaaggaaagaatgtaggtgttgtggatgagctagaaatc
cagtattacgagacgcagttggagttatatgatgttaagcttgagatactgaggaatgag
gagacgatccttgtcacacggttggactctgttaagagacttatagcagagaaacaagct
gaagtggtctactacgacccatgtgaaagccctgaggagctgaagagcctggctcctgac
ctggagctgcaccttggtgacaacagagagctgagagcactcagtcagcagtgccagcag
ctggaggctcagcggggccgcatctgctccaggagagcccaactcaggaacagaaaggat
cactgccgagaaaatcatcagcttagactgcaacaggccaaacaaaacgtgagacatttt
caccaccatcacagcatccagatgaaaagagacaaaataaaagaagaggaacaaaagaaa
aaagaatggatagaccatgaacgccagaaaacactggagcggctaagagcatatagggag
aagggtccagctcctcggtctgcactgaaaacgagttgctcagaatccatgctgtcaaac
ctgtcaggtggatgctctcagaagaggctctcaacagctcagcacaagaccgcagctcat
cctgcctccagcaaaaccagaagtgcttctcccttacctgaagccactgtgaaaccccct
gagcatcaagatccctgtggcagtgcccctggcctggcccttgctcctgttagtgaccag
acgctctctggatccagtgaagagatgtcactagcaccaccgccaccacctcccccccct
ccgccacttcctcctccaccacttcttcctccctctgctttgccctcttttcaaggtacc
actcatcagaatatagggttccagactctggcaacagaggaccagccgttccctctagcc
tgtgatatgtctgccagaagaccaggagggtctgattgccaggagggtttccagcgtcca
ggctctatggatgaagtgttggcctctctccggcagggcaggacctctctccggaaagta
gaaatgaccacccggccccctccccgcacctcggtcaatgaacaagttctggctgccatc
aggcagggggtgcagctgaagaaagtccacacaggccccaatgtggaccccagcaagaag
agcaccagcgacctggagaggagcatcagagaagccctggagagaatcaagaaagtgtct
gctgactcagaggaggacaatgatgaacagagccctgtcgagtgggaccgctag

DBGET integrated database retrieval system