KEGG   Rattus norvegicus (rat): 293059
Entry
293059            CDS       T01003                                 

Gene name
RGD1305713
Definition
(RefSeq) similar to RIKEN cDNA 3110040N11
  KO
K09131  uncharacterized protein
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    293059 (RGD1305713)
SSDB
Motif
Pfam: DUF167 ThiP_synth LAL_C2
Other DBs
NCBI-GeneID: 293059
NCBI-ProteinID: NP_001019920
RGD: 1305713
Ensembl: ENSRNOG00000052273
UniProt: Q505I4
Position
1q31
AA seq 126 aa
MPKKAGATSKGKNQTKEPETPPPPTGPVATDSKGFVTIAIHAKPGSKQNAVTDLNTEAVG
VAIAAPPSEGEANAELCRYLSKVLDLRKSDVVLDKGGKSREKVVKLLASTTPEEVLEKLR
TEAEKK
NT seq 381 nt   +upstreamnt  +downstreamnt
atgcctaagaaagccggtgcaacaagcaagggtaaaaaccaaaccaaggaaccagagaca
ccacctccccctacagggcctgtagcaactgattctaaaggctttgtcaccatagccatc
catgccaaacccggctccaaacagaatgctgtgacagatctgaacaccgaggcggtcggc
gtggccatcgcggcacctccgtctgagggagaggccaatgcggagctctgtcggtacctt
tccaaggtcttggacctcaggaagagtgacgtggttctggacaagggcggtaaatctcgg
gaaaaggtggtgaagctcttggcctctacaactccagaggaggtcttggagaagctgaga
acagaagctgaaaaaaaataa

DBGET integrated database retrieval system