KEGG   Rattus norvegicus (rat): 293072Help
Entry
293072            CDS       T01003                                 

Gene name
Olr10
Definition
(RefSeq) olfactory receptor 10
  KO
K04257  olfactory receptor
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09157 Sensory system
   04740 Olfactory transduction
    293072 (Olr10)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rno04030]
    293072 (Olr10)
G protein-coupled receptors [BR:rno04030]
 Others
  Chemoreception
   Olfactory
    293072 (Olr10)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_4 7tm_1 7TM_GPCR_Srsx LapA_dom Bacteriocin_IId
Motif
Other DBs
NCBI-GeneID: 293072
NCBI-ProteinID: NP_001000115
RGD: 1333106
Ensembl: ENSRNOG00000046729
UniProt: D4A4K1
Position
Xq31
AA seq 315 aa AA seqDB search
MAVYNLTSVTQFILIGLSDLPEVRYPLFVAFIMIYQITLLGNGIILLAILTERKLQTPMY
YLLTNLSLLDIFCPSATVPNMLKNLLTEDHRISYVGCALQLYFLVALAGTEVFLLAVMAY
DCYVAICFPLRYCLIMTKVRCVQLLFGTWAAGFLNSFVHTMSTFSLSFCKSNRVNQYYCD
IPPVVALSCSSTYVAEMLVLVVGGIFGVGAFLITLISYIYIVSTILKIQSAEGKRKAFST
CASHLLVVFLFYGTTIFTYIRPTSSQHSPGRDRLISMLYAVITPMLNPIIYSLRNKEVKG
ALRKVLHLRICSEKA
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atggctgtctacaatcttacctcagtgactcagttcatcctcataggactttctgacctc
cctgaggtacgctatccactctttgtggcctttatcatgatctatcagatcactttattg
ggaaacgggatcatcctgttggccattttgactgagagaaagcttcaaactcccatgtac
tatctgttgacaaatctgtctctgctggacatattctgcccatcagctactgtccccaat
atgctcaagaatctgttgactgaggatcacagaatttcttatgttgggtgtgctttgcaa
ctctatttcctggtggccctagctgggacagaagttttcttgttggctgtgatggcttat
gactgctatgtggccatatgcttccctctgcgatattgtctcatcatgaccaaagttcgc
tgtgtgcaactgttgtttgggacttgggcagctggatttctgaactcctttgtccataca
atgtccacttttagcctgtctttctgcaagtctaatagagttaatcagtactactgtgat
attccacctgtggtggccctgtcatgctcatccacttatgtggcagaaatgcttgtttta
gtggtgggaggtatctttggggttggtgcttttctgatcactttgatctcctacatatac
attgtttccaccatcctaaagatccagtcagcagaagggaagcgcaaagctttctccaca
tgtgcttcccatcttcttgtagtcttcttgttctatggcacaactatatttacctatatc
cgcccaacctccagtcaacactctcctggcagagacagactcatctctatgttgtatgca
gtcattacccccatgttaaaccccattatctacagcttgagaaacaaagaagtaaaagga
gcactcagaaaagttttacatcttaggatatgttcagagaaagcttga

DBGET integrated database retrieval system