KEGG   Rattus norvegicus (rat): 29310Help
Entry
29310             CDS       T01003                                 

Gene name
Mc3r
Definition
(RefSeq) melanocortin 3 receptor
  KO
K04201  melanocortin 3 receptor
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    29310 (Mc3r)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rno04030]
    29310 (Mc3r)
G protein-coupled receptors [BR:rno04030]
 Rhodopsin family
  Peptide
   Melanocortin
    29310 (Mc3r)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7tm_4 7TM_GPCR_Srsx
Motif
Other DBs
NCBI-GeneID: 29310
NCBI-ProteinID: NP_001020441
RGD: 3056
Ensembl: ENSRNOG00000004451
UniProt: P32244
Position
3q42
AA seq 323 aa AA seqDB search
MNSSCCPSSSYPTLPNLSQHPAAPSASNRSGSGFCEQVFIKPEVFLALGIVSLMENILVI
LAVVRNGNLHSPMYFFLCSLAAADMLVSLSNSLETIMIVVINSDSLTLEDQFIQHMDNIF
DSMICISLVASICNLLAIAVDRYVTIFYALRYHSIMTVRKALSLIVAIWVCCGICGVMFI
VYSESKMVIVCLITMFFAMVLLMGTLYIHMFLFARLHVQRIAALPPADGVAPQQHSCMKG
AVTITILLGVFIFCWAPFFLHLVLIITCPTNPYCICYTAHFNTYLVLIMCNSVIDPLIYA
FRSLELRNTFKEILCGCNGMNVG
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgaactcttcctgctgcccgtcctcctcttatccgacgctgcctaacctctcccagcac
cctgcagccccctctgccagcaaccggagtggcagtgggttctgcgagcaggttttcatc
aagccagaggtcttcctggcactgggcatcgtcagtctgatggaaaacatcctggtgatc
ctggctgtggtgaggaacggcaacctgcactcccccatgtacttcttcctgtgcagcctg
gctgcggccgacatgctggtgagcctgtccaactccctggagaccatcatgatcgtggtt
atcaacagcgactccctgaccttggaggaccaattcatccagcacatggacaacatcttc
gactctatgatctgcatctccctggtggcctccatctgcaacctcctggccatcgccgtg
gacaggtacgtcaccatcttctatgccctccgttaccacagcatcatgacggttaggaaa
gccctctccttgatcgtggccatctgggtctgctgcggcatctgcggcgtgatgttcatc
gtctactccgagagcaagatggtcatcgtgtgcctcatcaccatgttcttcgccatggtg
ctgctcatgggcaccctgtacatccacatgttcctcttcgccaggctgcacgtccagcgc
atcgcggcactgccacctgctgatggggtagccccgcagcagcactcgtgcatgaagggg
gccgtcaccatcaccatcctgctgggggttttcatcttctgctgggcgcctttcttcctc
cacctggtcctcatcatcacctgccccaccaacccctactgcatctgctacacggcgcac
ttcaacacctacctggttctcatcatgtgcaactctgtcatcgacccccttatctacgcc
ttccgcagcctggagctgcggaacaccttcaaggagattctctgcggttgcaatggcatg
aacgtgggctag

DBGET integrated database retrieval system