KEGG   Rattus norvegicus (rat): 293103
Entry
293103            CDS       T01003                                 

Gene name
Hikeshi, l7Rn6
Definition
(RefSeq) Hikeshi, heat shock protein nuclear import factor
  KO
K23327  protein Hikeshi
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:rno03110]
    293103 (Hikeshi)
Chaperones and folding catalysts [BR:rno03110]
 Other chaperones and cochaperones
  Others
   293103 (Hikeshi)
SSDB
Motif
Pfam: DUF775
Other DBs
NCBI-GeneID: 293103
NCBI-ProteinID: NP_001013919
RGD: 1359455
Ensembl: ENSRNOG00000017383
UniProt: Q5M808
Position
1q32
AA seq 158 aa
MLGTIPFPEGMGGSVYFSYPDSNGVPVWQLLGFVTNGKPSAIFKISGLKSGEGSQHPFGA
MNIVRTPSVAQIGISVELLDSLAQQTPVGSAAVSSVDSFTQFTQKMLDNFYNFASSFALS
QAQMTPNPSEMFIPANVVLKWYENFQRRLAQNPLFWKT
NT seq 477 nt   +upstreamnt  +downstreamnt
atgctgggaacaatcccatttcctgaggggatgggaggatctgtctacttttcctatcct
gattcaaatggggtgccagtatggcagctcctaggatttgtcacgaatgggaagccaagt
gccatcttcaaaatatcaggtcttaaatctggagaaggaagccagcacccatttggagcc
atgaatattgtgcgaaccccatctgttgcccagattggaatctcggtggagttgttggac
agtttggctcagcagactcccgtaggcagtgccgctgtgtcctcggttgactccttcaca
cagttcacacagaagatgttggacaacttctacaattttgcttcatcatttgctctctct
caggcccagatgacaccaaatccatcggaaatgttcatcccagcaaatgtggttctgaaa
tggtatgaaaactttcaaagacgactagcacagaaccctctcttttggaaaacataa

DBGET integrated database retrieval system