KEGG   Rattus norvegicus (rat): 293104
Entry
293104            CDS       T01003                                 

Gene name
Eed
Definition
(RefSeq) embryonic ectoderm development
  KO
K11462  polycomb protein EED
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rno03036]
    293104 (Eed)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Histone modification proteins
   Polycomb group proteins
    PRC2-EZH1 complex
     293104 (Eed)
    PRC2-EZH2 complex
     293104 (Eed)
SSDB
Motif
Pfam: WD40 Nup160
Other DBs
NCBI-GeneID: 293104
NCBI-ProteinID: NP_001099748
RGD: 1309782
Ensembl: ENSRNOG00000017509
UniProt: B5DF02
Position
1q32
AA seq 441 aa
MSEREVSTAPAGTDMPAAKKQKLSSDENSNPDLSGDENDDAVSIESGTNTERPDTPTNTP
NAPGRKSWGKGKWKSKKCKYSFKCVNSLKEDHNQPLFGVQFNWHSKEGDPLVFATVGSNR
VTLYECHSQGEIRLLQSYVDADADENFYTCAWTYDSNTSHPLLAVAGSRGIIRIINPITM
QCIKHYVGHGNAINELKFHPRDPNLLLSVSKDHALRLWNIQTDTLVAIFGGVEGHRDEVL
SADYDLLGEKIMSCGMDHSLKLWRINSKRMMNAIKESYDYNPNKTNRPFISQKIHFPDFS
TRDIHRNYVDCVRWLGDLILSKSCENAIVCWKPGKMEDDIDKIKPSESNVTILGRFDYSQ
CDIWYMRFSMDFWQKMLALGNQVGKLYVWDLEVEDPHKAKCTTLTHHKCGAAIRQTSFSR
DSSILIAVCDDASIWRWDRLR
NT seq 1326 nt   +upstreamnt  +downstreamnt
atgtctgagagggaagtgtcgactgcgccggcgggaacagacatgccggcggccaagaag
cagaagttgagcagcgacgagaacagcaacccggacctctcgggagacgagaatgacgat
gctgtcagtatcgagagtggcacaaacacagaacgcccggacacacccacaaatacacca
aatgcaccaggaaggaaaagctggggaaagggaaaatggaagtcgaagaaatgcaaatat
tctttcaaatgtgtgaacagcctcaaggaagatcacaaccagccattgtttggagttcag
tttaactggcacagtaaagaaggagatcctctggtgtttgcaactgtgggaagcaacaga
gtaaccttatatgaatgccattctcaaggggaaatacggttattgcagtcctatgtagat
gctgatgcagatgaaaacttttacacttgtgcatggacctatgatagcaacaccagccac
cctctgctagcagttgctggatctagaggcataataagaataattaatcctataacaatg
cagtgtataaagcactatgttggccatgggaatgctatcaatgagctgaaattccaccca
cgagacccaaaccttctcctgtcagtaagtaaagatcatgctttacgattatggaatatc
caaacagacactcttgtggcaatattcggaggtgtggaagggcacagagatgaagtgctg
agtgctgattatgatcttttgggtgaaaaaataatgtcctgtggtatggatcactctctt
aaactgtggagaatcaactcaaagagaatgatgaatgcgattaaggaatcttacgattat
aacccaaacaaaactaacaggccatttatttcccagaaaatccactttcctgatttttct
accagagacatacataggaattatgttgattgtgtacgatggttaggcgatttgatactt
tccaagtcttgtgaaaatgccattgtatgctggaaacctggcaaaatggaggatgatata
gataaaattaaacctagtgagtctaatgtgactattcttgggcgatttgattacagccag
tgtgacatttggtacatgaggttttctatggatttctggcaaaagatgcttgcattgggc
aatcaggttggcaaactgtatgtttgggatttagaagtagaagatcctcataaagccaaa
tgcacaacactgacccatcataaatgtggcgctgctattcgacaaaccagttttagcagg
gatagcagcatcctcatagctgtctgcgatgatgccagcatttggcgttgggatcgactt
cgataa

DBGET integrated database retrieval system