KEGG   Rattus norvegicus (rat): 293113
Entry
293113            CDS       T01003                                 

Gene name
Tmem126a, RGD1305677
Definition
(RefSeq) transmembrane protein 126A
  KO
K18157  transmembrane protein 126A
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:rno03029]
    293113 (Tmem126a)
Mitochondrial biogenesis [BR:rno03029]
 Mitochondrial protein import machinery
  Inner mambrane
   Other inner membrane factors
    293113 (Tmem126a)
SSDB
Motif
Pfam: TMEM126
Other DBs
NCBI-GeneID: 293113
NCBI-ProteinID: NP_001011557
RGD: 1305677
Ensembl: ENSRNOG00000022748
UniProt: Q5HZA9
Position
1q32
AA seq 196 aa
MESHKPSTNKDDLIFNIIPRKIKQLPESDRNLLEYGSAYIGLNAAFGGLIANSLFRRILN
VTQARVASSLPMAVIPFLTANLSYHSFVSLPLSTGNLNCEICTTTRGTLVGFVLGGLYPI
LLAIPVNGGLAARYESSPLPQRGNIFNYWITISKPVFRKMLFPTLLQTAFAAYLGSRQYK
LLIKALQLPEPDLEIQ
NT seq 591 nt   +upstreamnt  +downstreamnt
atggaaagtcataaaccaagtactaacaaagatgatttaatatttaatatcatacccaga
aaaatcaaacaacttccagaatcagacaggaatctgcttgaatatggatcagcatatatt
ggacttaatgctgcttttgggggcctaatagcaaacagtctatttcggcgaattttgaac
gtgacacaagctcgagtagcatctagcttgccaatggctgtgatcccatttttgacagca
aacctgtcctaccatagttttgtaagtttacctttgagtacaggtaatttgaactgtgaa
atctgtacgacaacacggggtacactagttggttttgttctgggtggtctgtaccccatc
cttttggctatacccgtgaatgggggccttgctgccaggtatgaatcaagtcctctacca
cagaggggaaacatcttcaattactggattactatttctaagcctgtctttagaaaaatg
ttatttcctactttacttcagactgcttttgcagcatatcttgggtctagacaatataaa
ctcctcataaaggcccttcagttacctgaacctgatttagaaattcaatga

DBGET integrated database retrieval system