KEGG   Rattus norvegicus (rat): 29316
Entry
29316             CDS       T01003                                 

Gene name
Adora2b
Definition
(RefSeq) adenosine A2B receptor
  KO
K04267  adenosine receptor A2b
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04015  Rap1 signaling pathway
rno04020  Calcium signaling pathway
rno04080  Neuroactive ligand-receptor interaction
rno04270  Vascular smooth muscle contraction
rno05034  Alcoholism
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    29316 (Adora2b)
   04020 Calcium signaling pathway
    29316 (Adora2b)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    29316 (Adora2b)
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    29316 (Adora2b)
 09160 Human Diseases
  09165 Substance dependence
   05034 Alcoholism
    29316 (Adora2b)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rno04030]
    29316 (Adora2b)
G protein-coupled receptors [BR:rno04030]
 Rhodopsin family
  Base and nucleoside
   Adenosine
    29316 (Adora2b)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7tm_4 7TM_GPCR_Srx GPR_Gpa2_C
Other DBs
NCBI-GeneID: 29316
NCBI-ProteinID: NP_058857
RGD: 2050
Ensembl: ENSRNOG00000002922
UniProt: P29276
Position
10q23
AA seq 332 aa
MQLETQDALYVALELVIAALAVAGNVLVCAAVGASSALQTPTNYFLVSLATADVAVGLFA
IPFAITISLGFCTDFHSCLFLACFVLVLTQSSIFSLLAVAVDRYLAIRVPLRYKGLVTGT
RARGIIAVLWVLAFGIGLTPFLGWNSKDRATSNCTEPGDGITNKSCCPVKCLFENVVPMS
YMVYFNFFGCVLPPLLIMMVIYIKIFMVACKQLQHMELMEHSRTTLQREIHAAKSLAMIV
GIFALCWLPVHAINCITLFHPALAKDKPKWVMNVAILLSHANSVVNPIVYAYRNRDFRYS
FHRIISRYVLCQTDTKGGSGQAGGQSTFSLSL
NT seq 999 nt   +upstreamnt  +downstreamnt
atgcagctagagacgcaggacgcgctgtacgtggcgctggagctggttatcgccgcgctg
gcagtggcgggcaacgtgctggtgtgcgctgcggtgggagcctcgagtgctttacagacc
cccaccaactactttctggtgtccctggcgacggcggacgtggctgtgggactcttcgcc
atcccctttgccatcaccatcagcctgggcttctgcacggactttcacagctgcctcttc
ctcgcctgcttcgtgctggtgctcacacagagctccatctttagcctcttggcggtggct
gtcgaccggtatctggccattcgcgtcccgctcaggtataaaggtttggtcactggaaca
cgagcaagagggatcatcgctgtcctctgggtccttgcctttggcattggactgactcct
ttcctgggttggaacagtaaagaccgtgccaccagcaactgcacagaacctggggatggc
atcacgaataagagctgctgccctgtgaagtgtctctttgagaacgtagttcccatgagc
tacatggtttatttcaacttctttgggtgtgtccttcctccactgctcatcatgatggtg
atctacatcaaaatcttcatggtggcctgcaagcagcttcagcacatggaactgatggag
cactccaggaccacgctgcagcgggagatccacgcggccaagtcactggctatgattgtg
ggcatctttgctctgtgttggctccccgtgcatgccatcaactgcatcaccctcttccat
ccagccctggccaaggacaagcccaaatgggtgatgaatgtggccatcctcctgtcacac
gccaattcagttgtcaatcccattgtctatgcctacaggaaccgggacttccgctacagt
ttccacaggatcatctccagatacgttctctgccagacggacaccaagggtgggagcggg
caggccgggggacagtcaactttcagtctgagcttgtga

DBGET integrated database retrieval system