KEGG   Rattus norvegicus (rat): 293165
Entry
293165            CDS       T01003                                 

Gene name
Sox6
Definition
(RefSeq) SRY box 6
  KO
K09269  transcription factor SOX5/6/13 (SOX group D)
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rno03000]
    293165 (Sox6)
Transcription factors [BR:rno03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   HMG SOX
    293165 (Sox6)
SSDB
Motif
Pfam: HMG_box HMG_box_2
Other DBs
NCBI-GeneID: 293165
NCBI-ProteinID: NP_001019922
RGD: 1309000
Ensembl: ENSRNOG00000020514
Position
1q35
AA seq 787 aa
MSSKQATSPFACTVDGEETMTQDLTSREKEEGSDQHPASHLPLHPIMHNKPHSEELPTLV
STIQQDADWDSVLSSQQRMESENNKLCSLYSFRNTSTSPHKPDEGSREREIMNSVTFGTP
ERRKGSLADVVDTLKQKKLEEMTRTEQEDSSCMEKLLSKDWKEKMERLNTSELLGEIKGT
PESLAEKERQLSTMITQLISLREQLLAAHDEQKKLAASQIEKQRQQMDLARQQQEQIARQ
QQQLLQQQHKINLLQQQIQQVQGHMPPLMIPIFPHDQRTLAAAAAAQQGFLFPPGITYKP
GDNYPVQFIPSTMAAAAASGLSPLQLQQLYAAQLASMQVSPGAKMPSTPQPPNSAGAVSP
TGIKNEKRGTSPVTQVKDETTAQPLNLSSRPKTAEPVKSPTSPTQSLFPASKTSPVNLPN
KSSIPSPIGGSLGRGSSLDILSSLNSPALFGDQDTVMKAIQEARKMREQIQREQQQQPHG
VDGKLSSMNSMGLSNCRNEKERTRFENLGPQLTGKSSEDGKLGPGVIDLTRPEDAEGSKA
MNGSAAKLQQYYCWPTGGATVAEARVYRDARGRASSEPHIKRPMNAFMVWAKDERRKILQ
AFPDMHNSNISKILGSRWKSMSNQEKQPYYEEQARLSKIHLEKYPNYKYKPRPKRTCIVD
GKKLRIGEYKQLMRSRRQEMRQFFTVGQQPQIPITTGTGVVYPGAITMATTTPSPQMTSD
CSSTSASPEPSLPVIQSTYGMKMDGASLAGNDMINGEDEMEAYDDYEDDPKSDYSSENEA
PEPVSAN
NT seq 2364 nt   +upstreamnt  +downstreamnt
atgtcttccaagcaagccacctctccatttgcctgtacagtggatggagaggaaacaatg
acccaggatttgacctcaagggaaaaggaagagggcagtgatcaacacccggcctcccat
ctgcctctgcaccccataatgcacaacaaacctcactctgaggagctgccgacgcttgtc
agtaccattcaacaagatgctgactgggacagcgttctgtcatctcagcaaagaatggag
tcagagaataataagttatgttccctatattccttccgaaatacgtctacctcaccacat
aagcctgacgaagggagtcgggagcgggaaataatgaacagtgttacttttggaaccccg
gaacgccgcaaagggagccttgccgatgtggtggatacgctgaagcagaagaagctggag
gagatgactcggacggaacaagaggattcctcctgcatggaaaaactactttcaaaagat
tggaaggaaaaaatggaaagactaaatacgagtgaacttcttggagaaatcaaaggtaca
cctgagagccttgcagagaaagaacggcaactctccaccatgattacccagctgatcagc
ttgcgggagcagctcctggcagcgcacgatgaacagaaaaagctggcagcctcgcagatc
gagaaacagcggcagcaaatggaccttgctcgccaacagcaagaacagatcgcaagacaa
cagcagcaacttctacagcagcagcacaagattaatctcctgcagcaacagatccagcag
gttcaggggcacatgcctccgctcatgatcccaatttttccacatgaccagcggaccttg
gcagcagctgctgccgcccaacagggattcctcttcccccctggaataacatacaagcca
ggtgataactaccccgtacagttcattccgtcaacaatggcagctgctgctgcttctgga
ctcagccctttacagcttcagcagctctatgccgctcagctggccagcatgcaggtgtca
cctggagcaaagatgccatcaactccgcagccaccaaactcagcaggggcggtctcacct
actgggataaaaaatgaaaagagagggaccagccctgtaactcaagttaaggatgaaaca
acagcccagccactgaatctctcatcccggccgaagacagcagagcctgtgaagtcccca
acatctcccacccagagcctcttcccagccagcaaaaccagccctgtcaacctgccaaac
aagagcagcatccccagccccatcgggggaagcctggggagaggatcctctttagatata
ctatccagtctcaactctcctgccctgtttggggaccaggacacagtgatgaaagctatc
caggaggctcggaagatgcgagaacagatccagcgggagcagcaacagcagccgcacgga
gttgatgggaagctgtcctccatgaacagcatggggctgagcaactgcaggaatgagaag
gaaagaacacgctttgagaacctgggtccccaattaacaggaaagtcaagtgaagatgga
aagctgggccctggtgtcatcgatctgactcggccagaggacgcagaaggaagcaaagca
atgaatggctctgcagctaaactacagcagtattattgttggccaacaggaggcgccact
gtggctgaagcacgcgtctacagggatgcccgaggccgtgccagcagcgagccccacatc
aagcgaccaatgaatgcgttcatggtttgggcaaaggacgaaaggaggaaaattcttcag
gccttccctgacatgcataactccaacattagcaaaatcttaggatctcgctggaaatcc
atgtccaaccaggagaagcaaccttactatgaagagcaggcccggctaagcaaaatccac
ctagagaagtacccaaactacaagtacaaaccccggccgaagcgcacgtgcattgtggac
ggcaagaagctccggatcggggagtacaagcagctgatgcgctcacgaaggcaggagatg
cgacagttcttcactgtggggcaacagcctcagattcccatcaccacaggaacaggtgtt
gtgtatcctggtgctattactatggcaacgaccacaccatcacctcagatgacatctgac
tgctctagcacctctgccagcccagagcccagcctccctgtcatccagagcacgtatggt
atgaagatggacggcgcgagcctggctgggaacgacatgattaatggcgaggatgaaatg
gaagcctatgacgactacgaagatgatcccaaatcagactatagcagcgaaaacgaggcc
ccagagcctgtcagtgccaactga

DBGET integrated database retrieval system