KEGG   Rattus norvegicus (rat): 293166
Entry
293166            CDS       T01003                                 

Gene name
Insc, RGD1311379
Definition
(RefSeq) inscuteable homolog (Drosophila)
Organism
rno  Rattus norvegicus (rat)
SSDB
Motif
Pfam: INSC_LBD
Other DBs
NCBI-GeneID: 293166
NCBI-ProteinID: NP_001099755
RGD: 1311379
Ensembl: ENSRNOG00000024712
UniProt: D3ZFP7
Position
1q35
AA seq 579 aa
MRRPPGDGDSTGEGPGNWGLWGAQESRRLCCVGPDRCGQALLQIGMNMMALPGGRHLGSI
PLQEQRLHFMQVDSVQRWMEDLKLMTECECMCVLQAKPISLEEDTQSDLILAGGPGPGDP
LQLLLKRGWVISTELRRIGQKLAQDRWARVHSMSVRLTCHARSMVSEYSTISRTTSQEMG
QAEKLLMEKCSELSAVTERCLQVENEHVLKSMKACVSETLSMLGQHFGQLLELALTREVQ
ALVRKIDTSDNIYITESTTGNLFSLTQEGAPLCRIIAKEGGVVALFKVCRQDTFRCLYPQ
ALRTLASICCVEEGVHQLEKVDGILCLTDILTDDSHSEATRAEAAAVVAQVTSPHLSFTQ
HLTSFLENMEEIVTALIKLCQEASSGEVFLLASAALANITFFEKMACEMLLQLNAIRVLL
EACGDKQRVDTPYTRDQIVTILANMSVLEQCASDIIQENGVQLIMGMLSEKPRSGTPAEV
AACERVQQKAAVTLARLCRDPDVAREAVRLSCMSRLIELCRSPSERNSSDAVLVACLAAL
RRLAGVCPEGLQDSDFQQLVQPRLVDSFLLCSNMEESFV
NT seq 1740 nt   +upstreamnt  +downstreamnt
atgaggcggcccccaggggatggagactccaccggagaaggcccaggaaactggggctta
tggggagcccaggagtccaggaggctgtgctgtgttgggccagaccgctgtgggcaggca
ctactgcagattggaatgaacatgatggcactacctggaggccggcacctgggttccatt
cctctgcaagagcagaggctacacttcatgcaggtggactcggttcagcgctggatggag
gatctgaagctcatgaccgagtgtgagtgcatgtgcgtcttgcaggcaaagcccatcagc
ctggaggaagacacgcagagtgaccttatcctagcaggtggtcctggaccaggagatcct
ctgcagctgctcctgaagcggggctgggtcatcagcacagagcttcgaaggatcgggcag
aagctggcccaggaccgctgggcacgcgtgcacagcatgagtgtgcgtctgacgtgccat
gcacgttccatggtcagcgagtacagcaccatcagcaggacaacctcgcaggaaatgggc
caggcagagaagctgctcatggagaaatgctccgagctctctgcggtcactgagaggtgc
ctccaagtggaaaatgagcatgttctgaagtcaatgaaggcctgcgtgagtgagaccctg
agcatgttgggccagcactttggccagctactggaactggccctcacacgggaagtgcag
gcacttgtgagaaaaatcgatacctcagacaatatctacatcacggaatctaccacaggg
aacctcttcagcctgacccaggagggggctcctttgtgccgcatcatagccaaggaaggt
ggggttgtagccctcttcaaggtctgccggcaggacaccttccggtgtttgtacccccag
gcgctccgcacactggcctctatctgctgtgtggaagagggtgtccatcagctggaaaag
gtggatggtatcctgtgcttgacggacatcttgactgatgatagccactcagaggccact
cgagctgaggctgcagccgtggtagcccaggttacctctccacatctgtctttcacccag
cacctcactagctttctggagaacatggaggagattgtgacagccctaatcaaactgtgc
caagaggcctcatcaggggaagtcttcctgctggcttctgcggcccttgccaatatcacc
ttcttcgaaaaaatggcctgtgagatgcttctgcagttgaatgcaatccgtgtccttctg
gaagcctgtggtgacaaacagagagtagacacaccttatactcgggaccagattgtgacc
atcttggcaaacatgtctgtgctggagcagtgtgcctctgacatcattcaggagaatggt
gtccagctcatcatgggcatgctgtcggagaagccaaggtctgggacgcctgctgaagtg
gcagcctgtgagagagtacagcagaaagctgcagtgaccctggcccgcctctgccgagac
ccagatgtggcccgggaggctgtgcggctcagctgtatgtctcgcctgattgagctctgc
agatccccctctgagaggaacagcagcgatgccgtcctggtagcctgcctggctgccttg
cgtcgcttggctggggtctgccccgaaggccttcaggactctgacttccagcagctggtc
cagcctcggcttgtggattccttcttgctgtgtagcaatatggaggagagttttgtttag

DBGET integrated database retrieval system