KEGG   Rattus norvegicus (rat): 29318
Entry
29318             CDS       T01003                                 

Gene name
Ddt
Definition
(RefSeq) D-dopachrome tautomerase
  KO
K10028  D-dopachrome decarboxylase [EC:4.1.1.84]
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    29318 (Ddt)
Enzymes [BR:rno01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.84  D-dopachrome decarboxylase
     29318 (Ddt)
SSDB
Motif
Pfam: MIF
Other DBs
NCBI-GeneID: 29318
NCBI-ProteinID: NP_077045
RGD: 61923
Ensembl: ENSRNOG00000001239
UniProt: P80254 A0A0F7RQJ6
Position
20p12
AA seq 118 aa
MPFVELETNLPASRIPAGLENRLCAATATILDKPEDRVSVTIRPGMTLLMNKSTEPCAHL
LISSIGVVGTAEQNRSHSSSFFKFLTEELSLDQDRIIIRFFPLEPWQIGKKGTVMTFL
NT seq 357 nt   +upstreamnt  +downstreamnt
atgccgttcgttgagttggaaacaaacttgccggctagccgcatacccgcagggctggag
aaccggttgtgtgcggccacagccaccatcctggacaaacccgaagaccgcgtgagcgtg
acgatacgaccgggcatgaccttgttgatgaacaaatccacagagccctgcgcccacctc
ctgatctcttccatcggtgttgtgggcaccgcggagcagaaccgcagccacagctccagc
ttcttcaagttcctcaccgaggagctgtccctggaccaggacaggatcattatccgattc
ttccccttggagccctggcagatcggaaagaaaggaactgttatgacgtttctgtga

DBGET integrated database retrieval system