KEGG   Rattus norvegicus (rat): 29322
Entry
29322             CDS       T01003                                 

Gene name
Plcb3
Definition
(RefSeq) phospholipase C beta 3
  KO
K05858  phosphatidylinositol phospholipase C, beta [EC:3.1.4.11]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00562  Inositol phosphate metabolism
rno01100  Metabolic pathways
rno04015  Rap1 signaling pathway
rno04020  Calcium signaling pathway
rno04022  cGMP-PKG signaling pathway
rno04062  Chemokine signaling pathway
rno04070  Phosphatidylinositol signaling system
rno04071  Sphingolipid signaling pathway
rno04072  Phospholipase D signaling pathway
rno04261  Adrenergic signaling in cardiomyocytes
rno04270  Vascular smooth muscle contraction
rno04310  Wnt signaling pathway
rno04371  Apelin signaling pathway
rno04540  Gap junction
rno04611  Platelet activation
rno04613  Neutrophil extracellular trap formation
rno04621  NOD-like receptor signaling pathway
rno04713  Circadian entrainment
rno04720  Long-term potentiation
rno04723  Retrograde endocannabinoid signaling
rno04724  Glutamatergic synapse
rno04725  Cholinergic synapse
rno04726  Serotonergic synapse
rno04728  Dopaminergic synapse
rno04730  Long-term depression
rno04742  Taste transduction
rno04750  Inflammatory mediator regulation of TRP channels
rno04911  Insulin secretion
rno04912  GnRH signaling pathway
rno04915  Estrogen signaling pathway
rno04916  Melanogenesis
rno04918  Thyroid hormone synthesis
rno04919  Thyroid hormone signaling pathway
rno04921  Oxytocin signaling pathway
rno04922  Glucagon signaling pathway
rno04924  Renin secretion
rno04925  Aldosterone synthesis and secretion
rno04926  Relaxin signaling pathway
rno04927  Cortisol synthesis and secretion
rno04928  Parathyroid hormone synthesis, secretion and action
rno04929  GnRH secretion
rno04933  AGE-RAGE signaling pathway in diabetic complications
rno04934  Cushing syndrome
rno04935  Growth hormone synthesis, secretion and action
rno04961  Endocrine and other factor-regulated calcium reabsorption
rno04970  Salivary secretion
rno04971  Gastric acid secretion
rno04972  Pancreatic secretion
rno04973  Carbohydrate digestion and absorption
rno05010  Alzheimer disease
rno05016  Huntington disease
rno05017  Spinocerebellar ataxia
rno05022  Pathways of neurodegeneration - multiple diseases
rno05142  Chagas disease
rno05143  African trypanosomiasis
rno05146  Amoebiasis
rno05163  Human cytomegalovirus infection
rno05200  Pathways in cancer
Module
rno_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    29322 (Plcb3)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    29322 (Plcb3)
   04310 Wnt signaling pathway
    29322 (Plcb3)
   04371 Apelin signaling pathway
    29322 (Plcb3)
   04020 Calcium signaling pathway
    29322 (Plcb3)
   04070 Phosphatidylinositol signaling system
    29322 (Plcb3)
   04072 Phospholipase D signaling pathway
    29322 (Plcb3)
   04071 Sphingolipid signaling pathway
    29322 (Plcb3)
   04022 cGMP-PKG signaling pathway
    29322 (Plcb3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    29322 (Plcb3)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    29322 (Plcb3)
   04613 Neutrophil extracellular trap formation
    29322 (Plcb3)
   04621 NOD-like receptor signaling pathway
    29322 (Plcb3)
   04062 Chemokine signaling pathway
    29322 (Plcb3)
  09152 Endocrine system
   04911 Insulin secretion
    29322 (Plcb3)
   04922 Glucagon signaling pathway
    29322 (Plcb3)
   04929 GnRH secretion
    29322 (Plcb3)
   04912 GnRH signaling pathway
    29322 (Plcb3)
   04915 Estrogen signaling pathway
    29322 (Plcb3)
   04921 Oxytocin signaling pathway
    29322 (Plcb3)
   04926 Relaxin signaling pathway
    29322 (Plcb3)
   04935 Growth hormone synthesis, secretion and action
    29322 (Plcb3)
   04918 Thyroid hormone synthesis
    29322 (Plcb3)
   04919 Thyroid hormone signaling pathway
    29322 (Plcb3)
   04928 Parathyroid hormone synthesis, secretion and action
    29322 (Plcb3)
   04916 Melanogenesis
    29322 (Plcb3)
   04924 Renin secretion
    29322 (Plcb3)
   04925 Aldosterone synthesis and secretion
    29322 (Plcb3)
   04927 Cortisol synthesis and secretion
    29322 (Plcb3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    29322 (Plcb3)
   04270 Vascular smooth muscle contraction
    29322 (Plcb3)
  09154 Digestive system
   04970 Salivary secretion
    29322 (Plcb3)
   04971 Gastric acid secretion
    29322 (Plcb3)
   04972 Pancreatic secretion
    29322 (Plcb3)
   04973 Carbohydrate digestion and absorption
    29322 (Plcb3)
  09155 Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    29322 (Plcb3)
  09156 Nervous system
   04724 Glutamatergic synapse
    29322 (Plcb3)
   04725 Cholinergic synapse
    29322 (Plcb3)
   04728 Dopaminergic synapse
    29322 (Plcb3)
   04726 Serotonergic synapse
    29322 (Plcb3)
   04720 Long-term potentiation
    29322 (Plcb3)
   04730 Long-term depression
    29322 (Plcb3)
   04723 Retrograde endocannabinoid signaling
    29322 (Plcb3)
  09157 Sensory system
   04742 Taste transduction
    29322 (Plcb3)
   04750 Inflammatory mediator regulation of TRP channels
    29322 (Plcb3)
  09159 Environmental adaptation
   04713 Circadian entrainment
    29322 (Plcb3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    29322 (Plcb3)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    29322 (Plcb3)
   05016 Huntington disease
    29322 (Plcb3)
   05017 Spinocerebellar ataxia
    29322 (Plcb3)
   05022 Pathways of neurodegeneration - multiple diseases
    29322 (Plcb3)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    29322 (Plcb3)
   04934 Cushing syndrome
    29322 (Plcb3)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    29322 (Plcb3)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    29322 (Plcb3)
   05142 Chagas disease
    29322 (Plcb3)
   05143 African trypanosomiasis
    29322 (Plcb3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    29322 (Plcb3)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     29322 (Plcb3)
Membrane trafficking [BR:rno04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    29322 (Plcb3)
 Endocytosis
  Macropinocytosis
   Phospholipase C
    29322 (Plcb3)
SSDB
Motif
Pfam: PI-PLC-X PLC-beta_C PH_14 PI-PLC-Y EF-hand_like C2 DUF1154
Other DBs
NCBI-GeneID: 29322
NCBI-ProteinID: NP_203501
RGD: 61993
Ensembl: ENSRNOG00000021150
UniProt: Q45QJ4
Position
1q43
AA seq 1236 aa
MAGARPGVHALQLEPPTVVETLRRGSKFIKWDEEASSRNLVTLRVDPNGFFLYWTGPNME
VDTLDISSIRDTRTGRYARLPKDPKIREVLGFGGPDTRLEEKLMTVVAGPDPVNTTFLNF
MAVQDDTVKVWSEELFKLAMNILAQNASRNTFLRKAYTKLKLQVNQDGRIPVKNILKMFS
ADKKRVETALESCGLNFNRSESIRPDEFSLEIFERFLNKLCLRPDIDKILLEIGAKGKPY
LTLEQLMDFINQKQRDPRLNEVLYPPLRSSQARLLIEKYEPNKQFLERDQMSMEGFSRYL
GGEENGILPLEALDLSMDMTQPLSAYFINSSHNTYLTAGQLAGTSSVEMYRQALLWGCRC
VELDVWKGRPPEEEPFITHGFTMTTEVPLRDVLEAIAETAFKTSPYPVILSFENHVDSAK
QQAKMAEYCRSIFGEALLIDPLDKYPLSAGTPLPSPQDLMGRILVKNKKRHRPSTGVPDS
SVRKRPLEQSNSALSESSAATEPSSPQLGSPSSDSCPGLSNGEEVGLEKTSLEPQKSLGE
EGLNRGPNVLMPDRDREDEEEDEEEEETTDPKKPTTDEGTASSEVNATEEMSTLVNYVEP
VKFKSFEAARKRNKCFEMSSFVETKAMEQLTKSPMEFVEYNKQQLSRIYPKGTRVDSSNY
MPQLFWNVGCQLVALNFQTLDLPMQLNAGVFEYNGRSGYLLKPEFMRRPDKSFDPFTEVI
VDGIVANALRVKVISGQFLSDRKVGIYVEVDMFGLPVDTRRKYRTRTSQGNSFNPVWDEE
PFDFPKVVLPTLASLRIAAFEEGGRFVGHRILPVSAIRSGYHYVCLRNEANQPLCLPALL
IYTEASDYIPDDHQDYAEALINPIKHVSLMDQRAKQLAALIGESEAQASTEMCQETPSQQ
QGSQLSSNPAPNPLDASPRWPPGPTTSPTSTSLSSPGQRDDLIASILSEVTPTPLEELRS
HKAMVKLRSRQDRDLRELHKKHQRKAVALTRRLLDGLAQARAEGKCRPSSSALSRATNVE
DVKEEEKEAARQYREFQNRQVQSLLELREAQADAETERRLEHLKQAQQRLREVVLDAHTT
QFKRLKELNEREKKELQKILDRKRNNSISEAKTREKHKKEVELTEINRRHITESVNSIRR
LEEAQKQRHERLLAGQQQVLQQLVEEEPKLVAQLTQECQEQRERLPQEIRRCLLGETSEG
LGDGPLVACASNGHAAGSGGHQSGADSESQEENTQL
NT seq 3711 nt   +upstreamnt  +downstreamnt
atggcgggcgcgaggcccggcgtccacgcgctgcagctggagccgcccaccgtggtggag
accctgcggcgcgggagtaaattcatcaaatgggacgaggaggcctccagtcggaacctg
gtgaccctgcgagtggaccccaatggcttcttcttgtactggacaggacccaacatggag
gtggacacactggacatcagctccatcagggacacaaggacaggtcgttatgcccgcctg
cccaaggaccccaagattcgagaggtactgggctttgggggtcctgacacccggctggag
gagaaactgatgacagtggtagcaggaccagatccagtaaacaccacattcttgaacttc
atggccgtgcaagatgacacagtcaaggtctggtcagaggagttgtttaagctggctatg
aacatactggctcagaacgcctcccggaacacgttccttcggaaagcatacacgaaactg
aagctgcaggtgaaccaggatggacggattccagtcaagaacattctgaagatgttctcc
gcggacaagaagcgggtggagactgcactggagtcctgcggcctcaacttcaaccggagt
gagtccattcggcctgatgagttttccttggaaatcttcgagcggttcttgaataagctg
tgtctgcgaccggatattgacaagatcctgctggagataggtgctaagggcaagccgtac
ctcactctggagcagctcatggactttatcaaccagaagcaaagagacccaagactcaac
gaggtgctgtacccaccgcttcgctcctcacaggctcggctgctcattgagaagtatgag
ccgaacaaacagttcctggagcgcgaccagatgtctatggagggtttcagccgctatctg
ggaggggaggagaatggcatcctgcccctggaggccctggatctgagcatggacatgacg
cagccactgagcgcatacttcatcaattcttcacacaatacctatctcactgcgggccag
ctggctggaacatcgtcagtggagatgtaccgccaggcgctgctgtggggctgccgttgt
gtggagctggatgtatggaagggacggccaccggaggaagagcccttcattacccatggt
ttcaccatgaccactgaggtgccattgcgtgatgtgttagaggccatcgccgagacagcc
ttcaagacctcaccctaccctgtcattctctccttcgaaaaccatgtggactcggcaaaa
cagcaggccaagatggcagagtactgccgctctatctttggggaagcgctgctcattgac
ccactggacaagtacccgctgtctgcgggcaccccccttcctagtccacaggacctgatg
ggccgtatcctggtgaagaataagaagcggcatcggcccagcacaggtgtccctgacagc
tccgtgcgcaagcggcctctggaacagagcaattcagccctgagtgagagctcagctgcc
acagagccctcctcaccccagctggggtcccccagctctgacagctgccctggcctaagc
aatggggaagaggtgggacttgagaagaccagcctggagcctcagaagtctctaggtgag
gagggcctcaaccgaggacctaatgttctcatgcctgaccgtgaccgagaggatgaggag
gaagatgaagaagaggaggaaacaacggatccaaaaaagcccaccaccgatgagggcaca
gccagcagtgaggtcaacgccacagaggagatgtcgacactcgtcaattacgttgagccc
gtcaagttcaagtcctttgaggctgctcgaaaaaggaacaagtgctttgagatgtcgtcc
tttgtggagaccaaggcgatggagcagctgaccaagagccccatggagttcgtggaatac
aacaaacagcagcttagtcgcatctaccccaagggcacccgtgtggactcctccaactac
atgcctcagctcttctggaacgtgggctgtcagcttgttgccctcaacttccagaccttg
gatttgccaatgcagctcaacgcaggcgtgtttgagtacaacgggcgcagtgggtacttg
ctcaagcctgagtttatgcggcggccggacaagtcttttgaccccttcactgaggtcatc
gtagatggcatagtggccaacgccttgcgggtcaaggtgatttcggggcagtttctgtct
gacaggaaggtgggcatctatgtcgaggtggacatgtttggtctcccagttgacacaaga
cgcaaatatcgcacacggacatcccaggggaactcattcaaccctgtgtgggatgaagaa
ccctttgacttccccaaggttgtgctgcccacgctggcctcacttcgcattgcagccttt
gaggagggtggcagatttgttgggcatcgtatcctgcctgtctctgctatccgctcagga
taccactacgtctgcctgcgaaatgaggccaaccaaccgttgtgcctgcctgccctgctt
atctacactgaagcttctgactacatcccagatgaccaccaggactatgcggaggccttg
atcaaccccatcaagcacgtcagcctaatggaccagcgggccaagcaactggctgctctc
attggggagagtgaggctcaggccagtacagaaatgtgtcaggagaccccgtctcaacag
caaggctcacagctctcctccaaccccgcacctaacccactggatgcctcacctcgatgg
cccccaggtcctaccacctcccccactagcacctccctcagtagcccagggcagcgagat
gatctgatcgccagcatcctttctgaggtgaccccaacacccctagaggagctccgaagc
cacaaggctatggtgaagctccggagccggcaggatcgagacctgagggaactgcataaa
aaacaccagcgcaaggctgtggccctcacccgccgccttctggatggcctggcccaggcc
agggctgaggggaagtgccggccctcctccagcgccctgagcagggccaccaatgtggaa
gacgtgaaggaggaagaaaaagaggcagccagacagtatcgagagttccagaaccgacaa
gtacagagcctgctggagctgagggaggcccaggcagatgcagagacagaacggaggctg
gagcatctgaaacaggctcagcagcggctcagggaggttgtcctggacgcacatacgact
cagttcaagaggctgaaggagttgaatgaaagggagaagaaggagcttcagaagatcctg
gacaggaagcgcaacaacagcatctcagaggccaagacaagggagaaacacaagaaggag
gtggaactgacagagatcaatcggaggcacatcactgagtcagtgaactccatcaggagg
ctggaagaggcccagaagcagcgccacgaacgcctcttggcagggcaacagcaggtcctc
cagcagctagtggaagaggagcccaagctggtggcccagctgacccaggagtgtcaggaa
cagcgagagaggctgccccaggagatccgtcggtgcctgctgggcgagacatcagaggga
ttgggggatggccccctggtggcctgtgccagcaatggtcatgcagctgggagtggtggg
caccagtccggcgctgactcggagagccaggaggaaaacacccagctttga

DBGET integrated database retrieval system