KEGG   Rattus norvegicus (rat): 29332Help
Entry
29332             CDS       T01003                                 

Gene name
Stmn1, Lap18, OP18, PP17, PP19, PR22, SMN, prosolin
Definition
(RefSeq) stathmin 1
  KO
K04381  stathmin
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04010  MAPK signaling pathway
rno05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    29332 (Stmn1)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    29332 (Stmn1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:rno04812]
    29332 (Stmn1)
Cytoskeleton proteins [BR:rno04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Stathmin
     29332 (Stmn1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Stathmin CCDC84 Ribonuc_2-5A Exonuc_VII_L zf-CRD
Motif
Other DBs
NCBI-GeneID: 29332
NCBI-ProteinID: NP_058862
RGD: 2992
Ensembl: ENSRNOG00000016810
Vega: OTTRNOG00000000744
UniProt: P13668
Position
5q36
AA seq 149 aa AA seqDB search
MASSDIQVKELEKRASGQAFELILSPRSKESVPEFPLSPPKKKDLSLEEIQKKLEAAEER
RKSHEAEVLKQLAEKREHEKEVLQKAIEENNNFSKMAEEKLTHKMEANKENREAQMAAKL
ERLREKDKHVEEVRKNKESKDPADETEAD
NT seq 450 nt NT seq  +upstreamnt  +downstreamnt
atggcatcttctgatattcaggtgaaagagctggagaagcgagcttccggccaggctttt
gagctgattctcagccctcgatcaaaagaatctgtccccgagttccccctttccccccca
aagaagaaggatctttccctggaggaaattcagaagaaattagaagctgcagaagaaaga
cgcaagtctcatgaagcagaagtcttgaagcagctcgctgagaagcgggagcatgaaaaa
gaagtgctccagaaagccattgaggagaacaacaacttcagcaaaatggcagaggagaaa
ctgacccacaaaatggaggctaacaaagagaaccgggaggcgcaaatggctgccaagctg
gagcgtttgcgagagaaggacaagcacgttgaagaggtgcggaagaacaaagaatccaaa
gaccccgcggacgagaccgaggctgactaa

DBGET integrated database retrieval system