KEGG   Rattus norvegicus (rat): 29335Help
Entry
29335             CDS       T01003                                 

Gene name
Oprk1
Definition
(RefSeq) opioid receptor, kappa 1
  KO
K04214  kappa-type opioid receptor
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    29335 (Oprk1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rno04030]
    29335 (Oprk1)
G protein-coupled receptors [BR:rno04030]
 Rhodopsin family
  Peptide
   Opioid
    29335 (Oprk1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srx 7TM_GPCR_Srv 7tm_4
Motif
Other DBs
NCBI-GeneID: 29335
NCBI-ProteinID: NP_058863
RGD: 69426
Ensembl: ENSRNOG00000007647
UniProt: P34975
Position
5q12
AA seq 380 aa AA seqDB search
MESPIQIFRGEPGPTCAPSACLLPNSSSWFPNWAESDSNGSVGSEDQQLEPAHISPAIPV
IITAVYSVVFVVGLVGNSLVMFVIIRYTKMKTATNIYIFNLALADALVTTTMPFQSAVYL
MNSWPFGDVLCKIVISIDYYNMFTSIFTLTMMSVDRYIAVCHPVKALDFRTPLKAKIINI
CIWLLASSVGISAIVLGGTKVREDVDVIECSLQFPDDEYSWWDLFMKICVFVFAFVIPVL
IIIVCYTLMILRLKSVRLLSGSREKDRNLRRITKLVLVVVAVFIICWTPIHIFILVEALG
STSHSTAVLSSYYFCIALGYTNSSLNPVLYAFLDENFKRCFRDFCFPIKMRMERQSTNRV
RNTVQDPASMRDVGGMNKPV
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atggagtcccccatccagattttccgcggagagccaggccctacctgtgctcccagtgct
tgcctactccccaacagcagctcttggttccccaactgggccgaatcggacagcaatggc
agtgtgggctccgaggaccagcagctggagcccgcgcacatctctccagccatccctgtt
atcatcaccgctgtctactctgtggtgtttgtggtgggcttagtgggcaattccctggtc
atgtttgtcatcatccgatacacaaagatgaagaccgcaaccaacatctacatatttaac
ctggctttggcagatgctttggttactaccactatgcccttccagagtgctgtctacttg
atgaattcttggccttttggagatgttctgtgcaagattgtcatttccattgactactac
aacatgtttaccagcatattcaccttgaccatgatgagtgtggaccgctacattgccgtg
tgccaccctgtgaaagctttggatttccgaacacctttgaaagcaaagatcatcaacatc
tgcatttggctactggcatcatctgttggtatatcagcgatagtccttggaggcaccaaa
gtcagggaagatgtggatgtcattgaatgctccttgcagtttcctgatgatgaatattcc
tggtgggacctcttcatgaagatctgtgtcttcgtctttgcctttgttatccctgtctta
atcatcattgtctgctacaccctgatgatcctgcgcttgaagagtgtccggctcctctcg
ggctctcgagagaaggaccgaaatctccgccggatcaccaagctggtgctggtagtggtt
gcagtcttcatcatctgttggacccccatccacatctttatcctggtcgaggctctaggc
agcacctcccacagcacagctgtcctctctagctattacttctgcattgccttgggttat
accaacagcagcttgaatcctgttctctatgcctttcttgatgaaaacttcaagcggtgt
tttagggacttctgcttccccattaagatgcgaatggagcgccagagcacaaacagagtt
agaaacacagttcaggatcctgcttccatgagggatgtgggtgggatgaataagccagta
tga

DBGET integrated database retrieval system