KEGG   Rattus norvegicus (rat): 29336
Entry
29336             CDS       T01003                                 

Gene name
Sigmar1
Definition
(RefSeq) sigma non-opioid intracellular receptor 1
  KO
K20719  sigma non-opioid intracellular receptor
Organism
rno  Rattus norvegicus (rat)
Pathway
rno05014  Amyotrophic lateral sclerosis
rno05022  Pathways of neurodegeneration - multiple diseases
Brite
KEGG Orthology (KO) [BR:rno00001]
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    29336 (Sigmar1)
   05022 Pathways of neurodegeneration - multiple diseases
    29336 (Sigmar1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rno02000]
    29336 (Sigmar1)
Transporters [BR:rno02000]
 Other transporters
  Accessory factors involved in transport [TC:8]
   29336 (Sigmar1)
SSDB
Motif
Pfam: ERG2_Sigma1R DUF4349
Other DBs
NCBI-GeneID: 29336
NCBI-ProteinID: NP_112258
RGD: 68364
Ensembl: ENSRNOG00000014604
UniProt: Q9R0C9
Position
5
AA seq 223 aa
MPWAVGRRWAWITLFLTIVAVLIQAVWLWLGTQSFVFQREEIAQLARQYAGLDHELAFSR
LIVELRRLHPGHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSHGHSGRY
WAEISDTIISGTFHQWREGTTKSEVYYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPS
TLAFALSDTIFSTQDFLTLFYTLRAYARGLRLELTTYLFGQDP
NT seq 672 nt   +upstreamnt  +downstreamnt
atgccgtgggctgtgggccggcggtgggcatggatcaccctgtttctgactattgtggcg
gtgctgatccaggcggtctggctgtggctgggtactcagagcttcgtcttccagagagaa
gagatagctcagcttgctcgacagtacgcagggctggaccatgagctggccttctctcgg
ctgatcgtggagctgcggaggctgcacccaggccacgtgctgccggatgaggagctgcag
tgggtgtttgtgaacgcgggcggctggatgggcgccatgtgtcttttgcacgcctcgctg
tctgagtacgtgctgctcttcggcaccgccctgggctcccatggccattcgggacgatac
tgggctgagatttcagataccatcatctctggcactttccaccagtggagagagggcacc
acaaaaagtgaggtctattacccaggagagacggttgtccatggacctggagaggcaaca
gctgtggagtggggaccaaacacgtggatggtggagtatggccggggtgttattccgtct
accctggcatttgcacttagtgacactattttcagcacccaggacttcctcaccctcttc
tatacccttcgcgcctatgcccggggcctccggcttgagctcaccacctacctctttggc
caagacccctga

DBGET integrated database retrieval system