KEGG   Rattus norvegicus (rat): 293375Help
Entry
293375            CDS       T01003                                 

Gene name
Olr231, ratchr1-164484422-164485369_ORF
Definition
(RefSeq) olfactory receptor 231
  KO
K04257  olfactory receptor
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09157 Sensory system
   04740 Olfactory transduction
    293375 (Olr231)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rno04030]
    293375 (Olr231)
G protein-coupled receptors [BR:rno04030]
 Others
  Chemoreception
   Olfactory
    293375 (Olr231)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_4 7tm_1 SLC3A2_N
Motif
Other DBs
NCBI-GeneID: 293375
NCBI-ProteinID: NP_001000206
RGD: 1333909
Ensembl: ENSRNOG00000019600
UniProt: F1M571
Position
1q32
AA seq 315 aa AA seqDB search
MTWGNWTTVKEFILTSFSSLSYEIQALLFLLFLIIYLVTLLGNVLIILVTTADSALQSPM
YFFLRNLSFLEIGFNLVIVPKMLSTLILQDKSISFLGCATQMYFFFFFGAAECCLLATMA
YDRYMAICDPLHYPIIMSCRSCAQLAAASWFSGFPVATVQTTWIFSFPFCGPNTVNHFFC
DSPPVIALVCADTSLFELEALTATVLFILFPFLLILGSYVRILATIFRMPSAEGKRKAFS
TCSSHLLVVSLFYSTAILTYFRPRSNTSPENKKMLSLSYTVVTPMLNPIIYSLRNNEVKA
ALRRIMHRTLGPQKL
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atgacctggggaaactggacaaccgtcaaggaatttattcttaccagcttctcaagcttg
tcttatgaaatacaagctctactatttctcctgtttttgatcatttacctagttacactc
ttgggcaatgtcctcatcatcctggttactacagctgactctgctctacaaagtcccatg
tacttcttccttagaaacttatccttcttggaaataggcttcaacttggtcattgtgccc
aagatgctgagtactctgatactgcaagacaaatccatctccttccttggctgtgctact
cagatgtatttcttctttttctttggggctgctgagtgctgcctcctggccacaatggca
tatgaccgctacatggctatctgtgatcccttgcactacccaataatcatgagctgcagg
tcctgtgcccagctagcagctgcctcttggttctcggggttcccggtggccactgtgcaa
accacatggattttcagtttccctttttgtggtcctaacaccgtaaaccacttcttttgt
gacagcccccctgtcatagccctggtctgtgctgatacctccctgtttgaactggaggct
ctgacagccacggttctgttcatcctctttcctttcttactgatcctgggttcctatgtc
cgcatcctcgccaccatcttcaggatgccttcagctgagggaaaacgcaaggccttttcc
acttgttcctcccatctcctggttgtctccctcttctacagtactgccatcctcacatat
ttccggccacgctcaaacacctcccccgagaacaaaaagatgctatcactctcctacaca
gtcgtcactccaatgttgaaccccatcatctacagcttaaggaataacgaggtgaaagct
gcactgaggcggatcatgcatagaactctgggtcctcagaagctatga

DBGET integrated database retrieval system