KEGG   Rattus norvegicus (rat): 29338Help
Entry
29338             CDS       T01003                                 

Gene name
Prdx2, Tdpx1
Definition
(RefSeq) peroxiredoxin 2
  KO
K03386  peroxiredoxin (alkyl hydroperoxide reductase subunit C) [EC:1.11.1.15]
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    29338 (Prdx2)
Enzymes [BR:rno01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.15  peroxiredoxin
     29338 (Prdx2)
Exosome [BR:rno04147]
 Exosomal proteins
  Proteins found in most exosomes
   29338 (Prdx2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: AhpC-TSA Redoxin 1-cysPrx_C
Motif
Other DBs
NCBI-GeneID: 29338
NCBI-ProteinID: NP_058865
RGD: 3838
Ensembl: ENSRNOG00000003520
UniProt: P35704
Position
19q11
AA seq 198 aa AA seqDB search
MASGNAHIGKPAPDFTGTAVVDGAFKEIKLSDYRGKYVVLFFYPLDFTFVCPTEIIAFSD
HAEDFRKLGCEVLGVSVDSQFTHLAWINTPRKEGGLGPLNIPLLADVTKSLSQNYGVLKN
DEGIAYRGLFIIDAKGVLRQITVNDLPVGRSVDEALRLVQAFQYTDEHGEVCPAGWKPGS
DTIKPNVDDSKEYFSKHN
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atggcctccggcaacgcgcacatcggaaagcctgcccctgacttcacgggcaccgccgtg
gtggatggtgcctttaaggaaatcaagctttcagactacagagggaagtacgtggtcctc
tttttctatccactggacttcacttttgtttgccccacggagatcatcgcttttagcgac
cacgctgaggacttccgaaagctaggctgcgaggtgctgggagtgtctgtggactctcag
ttcacccacctggcctggatcaataccccacggaaggagggaggcttgggcccactgaat
atccctctgcttgctgatgtgactaaaagcttgtcccagaattacggcgtgttgaaaaat
gatgagggcatcgcttacaggggcctctttatcatcgatgccaagggtgtccttcgccag
atcacagtcaacgacctacctgtgggacgctctgtagatgaggctctccgcctcgtccag
gcctttcagtatacagatgagcatggggaagtctgtcctgctggctggaagcccggcagt
gacaccatcaaacccaatgtggatgacagcaaggaatacttctccaaacacaactga

DBGET integrated database retrieval system