KEGG   Rattus norvegicus (rat): 29340
Entry
29340             CDS       T01003                                 

Gene name
Prkce
Definition
(RefSeq) protein kinase C epsilon type
  KO
K18050  novel protein kinase C epsilon type [EC:2.7.11.13]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04022  cGMP-PKG signaling pathway
rno04071  Sphingolipid signaling pathway
rno04270  Vascular smooth muscle contraction
rno04371  Apelin signaling pathway
rno04530  Tight junction
rno04666  Fc gamma R-mediated phagocytosis
rno04750  Inflammatory mediator regulation of TRP channels
rno04925  Aldosterone synthesis and secretion
rno04930  Type II diabetes mellitus
rno04931  Insulin resistance
rno04933  AGE-RAGE signaling pathway in diabetic complications
rno05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    29340 (Prkce)
   04071 Sphingolipid signaling pathway
    29340 (Prkce)
   04022 cGMP-PKG signaling pathway
    29340 (Prkce)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    29340 (Prkce)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    29340 (Prkce)
  09152 Endocrine system
   04925 Aldosterone synthesis and secretion
    29340 (Prkce)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    29340 (Prkce)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    29340 (Prkce)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    29340 (Prkce)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    29340 (Prkce)
   04931 Insulin resistance
    29340 (Prkce)
   04933 AGE-RAGE signaling pathway in diabetic complications
    29340 (Prkce)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rno01001]
    29340 (Prkce)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.13  protein kinase C
     29340 (Prkce)
Protein kinases [BR:rno01001]
 Serine/threonine kinases: AGC group
  PKC family [OT]
   29340 (Prkce)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr C1_1 C2 Pkinase_C ABC1 FTA2 Kinase-like Kdo PP_M1
Other DBs
NCBI-GeneID: 29340
NCBI-ProteinID: NP_058867
RGD: 61925
UniProt: P09216 Q6DUV1
Position
6
AA seq 737 aa
MVVFNGLLKIKICEAVSLKPTAWSLRHAVGPRPQTFLLDPYIALNVDDSRIGQTATKQKT
NSPAWHDEFVTDVCNGRKIELAVFHDAPIGYDDFVANCTIQFEELLQNGSRHFEDWIDLE
PEGKVYVIIDLSGSSGEAPKDNEERVFRERMRPRKRQGAVRRRVHQVNGHKFMATYLRQP
TYCSHCRDFIWGVIGKQGYQCQVCTCVVHKRCHELIITKCAGLKKQETPDEVGSQRFSVN
MPHKFGIHNYKVPTFCDHCGSLLWGLLRQGLQCKVCKMNVHRRCETNVAPNCGVDARGIA
KVLADLGVTPDKITNSGQRRKKLAAGAESPQPASGNSPSEDDRSKSAPTSPCDQELKELE
NNIRKALSFDNRGEEHRASSSTDGQLASPGENGEVRQGQAKRLGLDEFNFIKVLGKGSFG
KVMLAELKGKDEVYAVKVLKKDVILQDDDVDCTMTEKRILALARKHPYLTQLYCCFQTKD
RLFFVMEYVNGGDLMFQIQRSRKFDEPRSRFYAAEVTSALMFLHQHGVIYRDLKLDNILL
DAEGHCKLADFGMCKEGILNGVTTTTFCGTPDYIAPEILQELEYGPSVDWWALGVLMYEM
MAGQPPFEADNEDDLFESILHDDVLYPVWLSKEAVSILKAFMTKNPHKRLGCVAAQNGED
AIKQHPFFKEIDWVLLEQKKIKPPFKPRIKTKRDVNNFDQDFTREEPILTLVDEAIVKQI
NQEEFKGFSYFGEDLMP
NT seq 2214 nt   +upstreamnt  +downstreamnt
atggtagtgttcaatggccttcttaagatcaaaatctgcgaggccgtgagcttgaagccc
acagcctggtcgctgcgccatgcggtgggaccccggccccagacgttccttctggacccc
tacattgcccttaacgtggacgactcgcgcatcggccaaacagccaccaagcagaagacc
aacagtccggcctggcacgatgagttcgtcactgatgtgtgcaatgggcgcaagatcgag
ctggctgtctttcacgatgctcctatcggctacgacgacttcgtggccaactgcaccatc
cagttcgaggagctgctgcagaatgggagccgtcacttcgaggactggattgatctggag
ccagaaggaaaagtctacgtgatcatcgatctctcgggatcatcgggcgaagcccctaaa
gacaatgaagaacgagtgtttagggagcggatgcggccaaggaagcgccaaggggctgtc
aggcgcagggtccaccaggtcaatggccacaagttcatggccacctacttgcggcagccc
acctactgctcccactgtagggatttcatctggggtgtcataggaaaacagggatatcaa
tgtcaagtttgtacctgcgtcgtccacaaacgatgccatgagctcattattacgaagtgc
gctgggctaaagaaacaggaaacccctgacgaggtgggctcccaacgcttcagcgtcaac
atgccccacaagttcgggatccacaactacaaggtccccacgttctgtgaccactgtggc
tccctgctctggggcctcttgcggcagggcctgcagtgtaaagtctgcaaaatgaatgtt
caccgtcgatgcgagaccaacgtggctcccaattgtggggtggacgccagaggaattgcc
aaggtgctggccgatcttggcgttactccagacaaaatcaccaacagtggccagagaagg
aaaaagctcgctgctggtgctgagtccccacagccggcttctggaaactccccatcagaa
gacgaccgatccaagtcagcgcccacctccccttgtgaccaggaactaaaagaacttgaa
aacaacatccggaaggccttgtcatttgacaaccgaggagaggagcaccgagcctcgtcg
tctactgatggccagctggcaagccctggcgagaacggtgaagtccggcaaggccaggcc
aagcgcttgggcctggatgagttcaacttcatcaaggtgttaggcaaaggcagctttggc
aaggtcatgctggccgagctcaagggtaaggatgaagtctatgctgtgaaggtcttaaag
aaggacgtcatcctgcaggatgacgacgtggactgcacgatgacagagaagaggattttg
gctctggcgcggaaacacccttatctaacccaactctattgctgcttccagaccaaggac
cgcctcttcttcgtcatggaatatgtaaacggtggagacctcatgttccagattcagcgg
tcccgaaaattcgatgagcctcgttcccggttctatgctgccgaggtcacatctgctctc
atgtttctccaccaacatggagtgatctacagggatttgaaactggacaacatccttcta
gatgcagaaggtcactgcaagctggctgactttgggatgtgcaaggaagggattctgaat
ggcgtgacaactaccaccttctgtgggactcctgactacatagctccagagatcctgcag
gagttggagtacggcccctcagtggactggtgggccctgggcgtgctgatgtacgagatg
atggccgggcagcccccctttgaagctgacaacgaggacgacttgtttgaatccatcctt
cacgatgacgttctctaccctgtctggcttagcaaggaggctgtcagcatcctgaaagct
ttcatgaccaagaacccgcacaagcgcctgggctgcgtggcagcacagaacggggaagat
gccatcaagcaacatccattcttcaaggagattgactgggtactgctggagcagaagaaa
atcaagccccccttcaagccgagaattaaaaccaagagagatgtcaataactttgaccaa
gactttacccgggaagagccaatacttacacttgtggatgaagcaatcgtgaagcagatc
aaccaggaagaattcaaaggcttctcctactttggtgaagacctgatgccctga

DBGET integrated database retrieval system