KEGG   Rattus norvegicus (rat): 293410Help
Entry
293410            CDS       T01003                                 

Gene name
Swap70
Definition
(RefSeq) SWAP switching B-cell complex 70
  KO
K20072  switch-associated protein 70
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    293410 (Swap70)
Membrane trafficking [BR:rno04131]
 Endocytosis
  Macropinocytosis
   Others
    293410 (Swap70)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PH PH_11 PH_8 PH_3 EF-hand_6 EF-hand_5 EF-hand_1 PH_2 EF-hand_7
Motif
Other DBs
NCBI-GeneID: 293410
NCBI-ProteinID: NP_001099758
RGD: 1305579
Ensembl: ENSRNOG00000009910
UniProt: D3ZRE7
Position
1q33
AA seq 585 aa AA seqDB search
MGGLKDELLKAIWHAFTALDLDRSGKVSKSQLKVLSHNLCTVLKVPHDPVALEEHFRDDD
EGPVSNQGYMPYLNKFILEKVQDNFDKIEFNRMCWTLCVKKNLTKSPLLITEDDAFKVWV
IFNFLSEDKYPLIIVPEEIEYLLKKLTEAMGGGWQQEQFEHYKINFDDNKDGLSAWELIE
LIGNGQFSKGMDRQTVSMAINEVFNELILDVLKQGYMMKKGHKRKNWTERWFVLKPNIIS
YYVSEDLKDKKGDIMLDENCCVESLPDKDGKKCLFLIKCFDKTFEISASDKKKKQEWIQA
IHSTIHLLKLGSPPPHKEARQRRKELRRKLLAEQEELERQMKELQAANENKQQELESVRK
KLEEAASRAADEEKKRLQTQVELQTRFSTELEREKLIRQQMEEQVAQKSSELEQYLQRVR
ELEDMYLKLQEALEDERQARQDEETVRKLQARLLEEESSKRAELEKWHLAQQQAIQTTEA
EKQELEQQRVLKEQALQEAMAQLEQLELERKQALEQYEGVKRKLEMATNTTKSWKDKVAH
HEGLIRLIEPGSKNPHLITNWGPAAFTQAELEEREKSWKEKKTTD
NT seq 1758 nt NT seq  +upstreamnt  +downstreamnt
atggggggcttgaaagacgaactgctcaaagccatctggcacgccttcaccgcgctcgac
ctggaccgcagcggcaaggtctccaagtcgcaactcaaggtcctttcccataacctgtgc
acggtgctgaaggttccacacgaccctgttgcccttgaggagcacttccgggatgacgat
gaggggcctgtctccaatcagggctacatgccatatttaaacaagttcattttggaaaag
gtccaagacaactttgacaagattgaattcaatagaatgtgttggaccctctgtgtcaag
aaaaacctcacaaagagtccactccttattacagaagatgatgcattcaaagtgtgggtc
attttcaactttttgtcggaggacaagtatccattaattattgtgccagaagagatcgaa
tacctacttaagaaacttacagaagctatgggaggaggttggcaacaagagcaatttgaa
cattacaaaataaactttgatgacaataaagatggcctgtctgcctgggaacttattgaa
ctaattggaaatggacagtttagcaagggcatggatcgtcagacagtgtctatggccatt
aatgaggtcttcaatgagcttattttagatgtattgaaacagggttacatgatgaagaaa
ggccacaaacggaaaaactggactgagcgctggtttgtattaaaacccaacataatttcc
tactatgtgagcgaggatctgaaagataagaaaggagacatcatgttggatgaaaactgc
tgtgtggagtctctgcctgacaaagatggaaagaaatgtctttttctaataaaatgcttt
gataagacctttgaaatcagtgcctcggataagaagaagaaacaagaatggattcaggcc
atccattctaccatccatctgttgaagctgggcagccccccaccacacaaggaagcccgc
cagcgtcggaaagagctccgaaggaagctgctggcagagcaggaggagctggagcggcag
atgaaggagctccaagcggccaatgaaaacaagcagcaggagctggagagtgtgcggaag
aaactggaggaagcagcatctcgtgccgcagacgaggaaaagaagcgcctgcagactcag
gtagagctacagaccaggttcagcacagagttggagcgggagaagctgatcagacagcaa
atggaggagcaggttgcccagaagtcctctgaactggagcagtatctgcagcgagttcgg
gagctggaagacatgtacctaaagctgcaggaggcactggaggacgagaggcaggcccgg
caggatgaagagactgtgcgcaagcttcaggccaggctgctggaggaagagtcttctaag
agggcagagctggaaaagtggcacctggcacagcagcaggccattcagacaacagaggcg
gagaagcaggagttggaacagcagcgtgtcctgaaggagcaggccctgcaggaggccatg
gcacagctggagcagctggagttggagcggaagcaggccctggagcagtatgagggagtc
aaaaggaagctagagatggcaacaaatacgaccaagagctggaaggacaaagtggcccat
catgagggattaatacgcttgatagaaccaggttccaagaaccctcacctgatcaccaac
tggggacctgcagcattcacgcaggcagagctcgaggagcgagagaagagctggaaagag
aagaagaccacagactga

DBGET integrated database retrieval system