KEGG   Rattus norvegicus (rat): 293418Help
Entry
293418            CDS       T01003                                 

Gene name
Rpl27a
Definition
(RefSeq) ribosomal protein L27a
  KO
K02900  large subunit ribosomal protein L27Ae
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03010  Ribosome
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    293418 (Rpl27a)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:rno03011]
    293418 (Rpl27a)
Ribosome [BR:rno03011]
 Ribosomal proteins
  Eukaryotes
   Large subunit
    293418 (Rpl27a)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ribosomal_L27A
Motif
Other DBs
NCBI-GeneID: 293418
NCBI-ProteinID: NP_001099760
RGD: 1309771
Ensembl: ENSRNOG00000014214
UniProt: P18445
Position
1q33
AA seq 148 aa AA seqDB search
MPSRLRKTRKLRGHVSHGHGRIGKHRKHPGGRGNAGGMHHHRINFDKYHPGYFGKVGMRH
YHLKRNQSFCPTVNLDKLWTLVSEQTRVNAAKNKNGVAPIIDVVRSGYYKVLGKGKLPKQ
PVIVKAKFFSRRAEEKIKGVGGACVLVA
NT seq 447 nt NT seq  +upstreamnt  +downstreamnt
atgccatccagactgaggaagacccggaaactccggggccacgtgagccacggccacggt
cgcatcggtaagcaccgcaagcacccaggaggccgcgggaatgctggaggcatgcatcac
cacaggatcaactttgacaaatatcatccaggttacttcggcaaagttggcatgaggcat
taccacttgaagaggaaccagagcttctgcccaactgtcaacctggataaattatggacg
ttggtcagcgagcagacacgggtcaatgcagcaaaaaacaagaatggagttgctcccatc
attgacgttgttcgatcaggctactacaaagttctggggaaggggaagctccctaagcaa
cctgtcatcgtgaaggccaagttcttcagcagaagagctgaagagaagataaagggtgtg
ggaggtgcctgtgtcctggtggcttaa

DBGET integrated database retrieval system