KEGG   Rattus norvegicus (rat): 29344
Entry
29344             CDS       T01003                                 

Gene name
Zfp36l1
Definition
(RefSeq) mRNA decay activator protein ZFP36L1
  KO
K18753  butyrate response factor
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    29344 (Zfp36l1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:rno03019]
    29344 (Zfp36l1)
Messenger RNA biogenesis [BR:rno03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     29344 (Zfp36l1)
SSDB
Motif
Pfam: Tis11B_N zf-CCCH zf_CCCH_4 zf-CCCH_4 zf-CCCH_2 Torus Zn_finger_prot
Other DBs
NCBI-GeneID: 29344
NCBI-ProteinID: NP_058868
RGD: 62009
Ensembl: ENSRNOG00000058646
UniProt: P17431
Position
6
AA seq 338 aa
MTTTLVSATIFDLSEVLCKGNKMLNYSTPSAGGCLLDRKAVGTPAGGGFPRRHSVTLPSS
KFHQNQLLSSLKGEPAPTLSSRDSRFRDRSFSEGGERLLPTQKQPGSGQVNSSRYKTELC
RPFEENGACKYGDKCQFAHGIHELRSLTRHPKYKTELCRTFHTIGFCPYGPRCHFIHNAE
ERRALAGGRDLSADRPRLQHSFSFAGFPSAAATAAATGLLDSPTSITPPPILSADDLLGS
PTLPDGTNNPFAFSSQELASLFAPSMGLPGGGSPTTFLFRPMSESPHMFDSPPSPQDSLS
DHEGYLSSSSSSHSGSDSPTLDNSRRLPIFSRLSISDD
NT seq 1017 nt   +upstreamnt  +downstreamnt
atgaccaccaccctcgtgtccgccaccattttcgacttgagcgaagttttatgcaagggt
aacaagatgctcaactacagcactcccagtgctgggggctgcctgctggacaggaaggca
gtgggcacccctgctggcgggggcttccctcggaggcactcggtcactctgcccagctcc
aagttccatcagaaccagcttctcagcagtcttaagggtgagccggccccgaccctgagc
tcacgcgacagccgctttcgagaccgctctttctccgaagggggcgagcggctgctgccc
actcagaagcagcctgggagcggccaggtcaactccagccgctacaaaacggagctgtgc
cgccccttcgaagaaaacggtgcctgtaagtacggggacaagtgccagttcgcgcacggc
atccacgagctccgcagcctgacccgccaccccaagtacaagacggagctgtgccgcacc
ttccacaccatcggcttttgcccttatgggccccgctgccacttcattcacaacgccgag
gagcgacgcgccctggcggggggccgggacctctccgctgaccgtccccgcctccagcat
agctttagctttgctgggtttcccagtgccgctgccaccgccgctgccacggggctgctg
gacagccccacgtccatcaccccaccccccatcctgagcgccgatgacctcttgggctca
cctaccctgcccgatggcaccaataaccccttcgccttttccagccaggagctggcgagc
ctctttgctcctagcatggggctgcccgggggaggctcccccaccaccttcctcttccgg
cctatgtccgaatcccctcacatgtttgactctccccccagccctcaggattctctctcg
gaccatgagggctacctgagcagctccagcagcagccacagtggctcagactcccctacc
ttggacaactcaagacgcctgcccattttcagcagactctccatctcagatgactaa

KEGG   Rattus norvegicus (rat): 298765
Entry
298765            CDS       T01003                                 

Gene name
Zfp36l2
Definition
(RefSeq) zinc finger protein 36, C3H1 type-like 2
  KO
K18753  butyrate response factor
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    298765 (Zfp36l2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:rno03019]
    298765 (Zfp36l2)
Messenger RNA biogenesis [BR:rno03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     298765 (Zfp36l2)
SSDB
Motif
Pfam: Tis11B_N zf-CCCH zf_CCCH_4 zf-CCCH_4 zf-CCCH_2 Torus Zn_finger_prot
Other DBs
NCBI-GeneID: 298765
NCBI-ProteinID: NP_001031703
RGD: 1308913
Ensembl: ENSRNOG00000005067
UniProt: D3ZHK9
Position
6
AA seq 482 aa
MSTTLLSAFYDIDFLCKTEKSLANLNLNNMLDKKAVGTPVAAAPSSSFTPGFLRRHSASN
LHALAHPSPGSCSPKFPGAPNGSSCGPAGAGGPSSYGQLKEPSGGSGTALVNKESKFRDR
SFSENGERSQHLLHLQQQQKGGSGSQINSTRYKTELCRPFEESGTCKYGEKCQFAHGFHE
LRSLTRHPKYKTELCRTFHTIGFCPYGPRCHFIHNADERRPAPSGGASGDLRAFGARDAL
HLGFAREPRPKLHHSLSFSGFPSGHHQPPGGLESPLLLDSPTSRTPPPPSCSSASSCSSS
ASSCSSTSAASTPSGAPTCCASAAAAAAAALLYGPGGAEDLLTPGAPCATCSTTSCANNA
FTFGPEVSSLITPLAIQTHNFAAAAAAYYRSQQQGLAGLAPAPAQPPAAPAPPSPPFGFQ
LPRRLSESPVFDAPPSPPDSLSDRDSYLSGSLSSGSLSGSESPSLDPGRRLPIFSRLSIS
DD
NT seq 1449 nt   +upstreamnt  +downstreamnt
atgtcgaccactcttctgtcagctttctacgatatcgacttcttgtgcaagacggagaaa
tccctggcaaacctcaatctgaacaacatgctggacaagaaggcggtggggacgcccgtg
gctgctgcccccagctcgagcttcactccggggttcctgagacgccactccgccagcaac
ctacacgcgctcgcccaccccagtcctggcagctgctcgcctaagttcccaggcgcccct
aacggcagcagctgtggcccggcaggcgcgggcggcccgtcctcctacggccagctcaag
gagccttcagggggcagcggcacggcgctggtcaacaaggaaagcaaattccgggatcgc
tctttcagcgagaacggtgagcgcagccagcacctcctgcacctgcagcagcagcagaag
gggggcagcggctcccaaatcaactccacgcgctacaagaccgagctgtgccggcccttc
gaggagagcggcacgtgcaagtacggcgagaagtgccagttcgcgcacggcttccatgag
ctgcgcagcctcactcggcaccccaagtacaagacggagctgtgccgcaccttccacacc
atcggcttctgcccctacggcccgcgctgccatttcatccacaacgcagacgagcggcgg
cccgcaccatcggggggcgcctccggggacctgcgagcgtttggcgcgcgcgacgcgctg
cacctgggctttgcccgggagccgcggccaaagctgcaccacagcctcagtttctccggc
ttcccgtcgggccaccaccagccgcccgggggactggagtcgccgctgctgctcgacagc
cccacgtcgcgcacgccgccgccgccctcctgttcctccgcctcgtcctgttcctcatca
gcctcttcctgctcctccacctcagcggcctccacaccctcgggcgccccgacgtgctgt
gcctcagcggcggcggcggcggcggccgcgctgctctacggccccggaggcgcggaggac
ctgctgactcccggagcgccgtgcgccacttgctcgaccacctcgtgcgccaacaacgcc
ttcaccttcggcccggaggtgagcagcctcatcacgccacttgccatccagacccacaac
ttcgccgccgcggccgccgcctactaccgcagccagcagcagggcctggcgggcctcgcg
ccggcccctgcgcagccccccgcggcccccgcgccgccctcgccgcccttcggcttccag
ctgccgcgccgtctgtccgagtcgccggtgttcgacgcgccccccagccccccggactcg
ctgtcggaccgcgacagttacctgagtggctcgctgagctcgggcagcctcagcggctcc
gagtcccccagcctggaccccggccgccgcctgcccatcttcagccgcctctccatctcc
gacgactga

DBGET integrated database retrieval system