KEGG   Rattus norvegicus (rat): 293442
Entry
293442            CDS       T01003                                 

Gene name
Abca15
Definition
(RefSeq) ATP-binding cassette, subfamily A (ABC1), member 15
  KO
K05643  ATP-binding cassette, subfamily A (ABC1), member 3
Organism
rno  Rattus norvegicus (rat)
Pathway
rno02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    293442 (Abca15)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rno02000]
    293442 (Abca15)
Transporters [BR:rno02000]
 ABC transporters, eukaryotic type
  ABCA (ABC1) subfamily
   ABCA1, 2, 3, 4, 7, 12, 13 subgroups
    293442 (Abca15)
SSDB
Motif
Pfam: ABC_tran ABC2_membrane_3 AAA_21 AAA_15 AAA_23 DUF4162 ABC2_membrane AAA_29 RsgA_GTPase AAA_27 YhfZ_C
Other DBs
NCBI-GeneID: 293442
NCBI-ProteinID: NP_001099763
RGD: 1305981
Ensembl: ENSRNOG00000027505
UniProt: D4ACN5
Position
1q36
AA seq 1668 aa
MASPASKKLLLLLWKNFTLKRRKFGALVTEIILMLAFSIVLLTTRHLLSINKMESLHFPD
QPVGAVPFFFRVSANSSRPWELAYVPSNITVVHNIVENVKKDLNFPMAVIGFPSESDFED
YARSSVNSRNILAAIVFDHNFANSRDPLPKKIKYNLRFSDIKKNIHGMAYYQGHTWLTKF
LFPPLRIVGPRNPQEADGGSPGYITEGFLAVQHALDKAIMLHHGGAAATALFNDVSLFIQ
RFPYPAYYHDHFYLFANTFVPLTVASIFFLNHLILVWSIVWEKENRLKEYQLMIGLRNWM
FWIAYFFTFFCLYFINIIFMCIVLFVKIDPAPIFQYNDPILVFILLLFYAISSIFFSFMI
STLFNRVSFAVSLGSFLFFLTYLPAITMNQSFEHMPPRQKLIWSFDFNVGMAFGFRFLVN
AETRKTGMKWNNIFLPTDSDSLLFTYVLGMLLVDAFIYGLVAWYIEAVFPGEYGVPKPWN
FFLMHSYWFGESRQQKPEITQFCKRVESKYFEVEPTDLTAGIQIKHLHKVFQENNITKVA
INDLSLNVYEGQITVLLGHNGAGKSTTLSILSGLYPPTSGEAYVHGEDISQHMDQIRNFL
GLCPQQNLLFDHLTVSEHLYFYCRVKGVPQNMCLEETNNMLSAFNLTEKRDAFSKSLSGG
MKRKLAIIIALIGGSKVVILDEPTSGMDPASRRSTWDVVQTYKQNRTILLTTHYMDEADM
LGDRIAIMVQGTLRCCGSSVFLKRLYGVGSHIVMVKEPVCDVDEISKLIHYYIPTATLKT
NVGNELSFILPKEYTHKFEALLTALEENQENLGISSFGMSITTMEEVFLRVSKMEDSKPD
MEATQSPSAGSKGNRNRDVESSMRAGFPTQSEDQTIVFNTGCPLYLQQFHAMFMKRLMYN
WRNWRVLSVQILGLVISTFLLLKSHEFRHKRIRQMNLDDYGQTIVPFSILGKSNLTTSLL
IHLENMLKPGNHQLKEVQGDLLKYLEGNEECIHLCIVALSIKVAAGRAKLTVLFNNEAYH
SPSLSLAVLDNILFMSLSGANASITVFHKPQPRPTSKEWPRSTYGKIVAFKIQLGMALLV
SGFCILTVTERITKAKHMQFLSGASVLVYWLSALVFDFIIFFISCCFLLVMFKYYKIDIY
VTDYHILETMLILILFGWSAIPLTYLMSFLFSKSIPAYIQLLVFYYLSGTSGLLIDTIIE
AGLSTIISNSTQTFLLSSLLFFPTYNLGKCISEYTVIYQRKILCIQQKNVLKYLNCSKEY
TKKNIYSLKKPMIGKYLIAMSIAGFVYLLFIFFWENISWKLRMLIHQHIYFGVCKKYKSD
IISNELSGTSEDNDVENERREILYQPEKFLNCPVLIKQLTKIYFKSPLILAVKNISLAIQ
ERECFGLLGFNGAGKTTTFQILTGEITPTAGDVFIDGISITKDVLKVRSKIGYCPQFDAL
LEYLTGWEIMVMYARIWGISERQIRPYVNTYLNSLELEPHANSLISTYSEGNKRRLSTAI
AMMGKPSVIFLDEPSTGMDPRARRLLWDAVIKIRESGKAIIITSHSMEECEALCTRLSIM
VHGKLTCLGSPQYLKNKFGDIYILKTKVKSGETLKEFKNFITLTFPGSELKQENQGILNY
YIPSKDNSWGKVFGILEKAKEQYDLEDYSISQITLDQVFLAFADQDRK
NT seq 5007 nt   +upstreamnt  +downstreamnt
atggcttcaccagcatcaaaaaaacttttgctccttctgtggaagaactttactttaaag
aggcggaagtttggggctttagttactgagataatcctgatgcttgcgttcagcattgtg
cttttgacaacacgccaccttcttagcataaacaagatggagtccctgcattttcctgac
caacctgtcggtgctgttcctttcttcttccgagtctctgccaacagttctcgtccttgg
gagctggcttatgtgccttccaacatcacggtggtacacaatattgtcgaaaatgtgaaa
aaggatttaaacttccctatggcagttatagggtttccttcagaaagtgattttgaagat
tacgctaggtcatctgtcaactctagaaatattctggctgctattgtgtttgaccacaac
ttcgcaaacagtagagaccctctgccaaagaagataaaatacaatctgcgatttagtgat
attaaaaagaacatacatggtatggcatattatcaagggcacacctggcttacaaaattt
ctctttccacctttgcgtattgtgggacccagaaatccacaggaagcagatggaggcagt
cctgggtacattactgaaggattcctggctgtgcaacatgccctagacaaggccatcatg
ctccaccatggtggagctgctgcaacggcactcttcaatgatgttagccttttcattcag
agatttccataccctgcatattatcatgatcacttctatttgtttgctaatacttttgtc
cctctaacagtggcaagtatcttctttttgaatcatcttatcttagtttggtccattgtg
tgggaaaaggaaaaccgattaaaggaataccagctcatgataggactgagaaactggatg
ttctggattgcctatttcttcaccttcttctgtttgtattttattaacattatatttatg
tgcattgttttatttgtcaagattgatcctgcgccaatattccaatacaatgacccaatc
cttgtcttcatccttttgttattttatgccatctcctcgatattcttcagttttatgatt
agcacattgtttaatagagtcagttttgctgtgagcttgggaagtttcctttttttcctc
acctacttaccagctattacaatgaatcaaagctttgagcacatgccacccaggcagaag
ctgatttggtccttcgacttcaatgttgggatggcatttggatttagattcctagtcaat
gcagaaacaaggaaaactggaatgaaatggaataacatattcctaccaacggattcagac
agccttttatttacctatgtgctaggaatgcttttagttgatgctttcatatatggcctt
gtggcctggtacatagaagctgtctttccaggagagtacggtgtgccaaagccgtggaac
tttttcttgatgcactcttactggtttggagaatcacgtcaacaaaaacccgaaataacc
caattttgtaagagagttgaaagcaagtattttgaagttgaaccaactgatttgacagca
ggcatccagatcaaacacctacacaaggtattccaagagaataacatcactaaagtcgcc
atcaatgacttgtctttgaacgtatatgagggacagattactgttcttttaggacataat
ggggcaggaaagtccactactctgtccatcctctcaggtctctatcccccgaccagtgga
gaggcctatgttcatggagaagacatctcacagcatatggatcaaattaggaatttcttg
ggcttatgtcctcagcagaacctgttgtttgatcacttgacagtatcagaacacctttat
ttctactgcagggtaaaaggagtgcctcaaaatatgtgtcttgaggaaactaacaatatg
ctgtcagcttttaacctgacagaaaagcgtgatgcattttcaaagtcattgagtggaggc
atgaagcgcaaactcgccatcataatagccctgatagggggctccaaggtggtgatactt
gatgagccaacatctggcatggacccagcctcaaggagaagcacctgggatgtcgttcaa
acttataaacagaatcgtaccatcctgctgaccacccactacatggatgaagctgatatg
ctgggtgatcgcattgctatcatggtccagggaaccttgcgatgctgcggatcctctgtc
ttcctgaaaagactatatggtgttggaagccacatagtcatggtgaaggaacctgtctgt
gacgttgatgaaatctcaaaactgatccattactacataccaacagccaccctgaagact
aatgttggaaatgagttatcttttattctacccaaagaatatacacacaagtttgaagct
ctcttgactgctctggaagagaaccaagaaaaccttggcatctctagctttggtatgtct
atcactaccatggaagaagtcttccttagggtcagtaaaatggaagactcaaaaccagat
atggaagctacccagtcgccctctgcaggaagcaaagggaacaggaatagagatgttgaa
agtagcatgagagcaggctttcccacccagagtgaagaccagaccattgtgtttaacact
gggtgtcccctctacctgcagcagttccatgcaatgttcatgaagaggctgatgtacaat
tggcgaaactggagggtgctttcagtgcagatactggggcttgtcatttctactttctta
ctcctcaagtctcatgagtttagacataagagaatcaggcaaatgaatttggatgactat
ggtcaaaccattgtgcctttttctattttggggaaatctaatttgacaacaagtctctta
atacaccttgagaatatgctaaaacctggcaaccaccagctcaaggaagtacaaggagac
ctcctcaagtacttggaggggaatgaagaatgcatccatttatgtattgttgcactttcc
atcaaggtagctgcaggtagagcgaagcttaccgttctgttcaacaacgaagcctaccat
tcgccatctctgtccctggcagttttagacaacattctcttcatgtcactttctggtgcc
aatgcttccataacagtcttccataaacctcagccacgacccaccagcaaagagtggcca
cggagtacctatgggaagattgtggccttcaaaattcagctgggcatggctcttctggtc
agtggcttttgcatcctcacggtgactgagcgaatcaccaaggcaaagcacatgcagttt
ctgagtggggcttctgtccttgtgtactggctttcagctctggtgtttgactttattatc
ttcttcatttcttgctgcttcctattggttatgttcaaatactacaaaattgacatctat
gtcactgactaccacattttggaaacgatgctgatcctcatactgtttggatggtctgcc
atccccctcacatacctgatgagcttcctgttttctaaaagcatccctgcctacatccaa
cttctggtgttctattatctctctggcacttctggtctcttgatagataccataatagaa
gccggattatcaaccatcatatccaactccacccaaactttcctgctcagttcgctgctg
ttctttcccacgtacaaccttgggaagtgcatcagtgagtacactgttatttaccagagg
aaaatactatgcatccagcaaaagaatgttctcaaatacctgaattgtagcaaggaatac
accaagaagaacatttattctttgaagaagcctatgattggaaagtatttaattgccatg
agcatcgctggctttgtttaccttctcttcattttcttttgggaaaatatctcatggaaa
ttaaggatgctcatccaccaacacatttactttggtgtctgcaagaaatacaagtcggat
ataatttccaatgaattatctgggacttctgaagataatgatgtagaaaacgagagaaga
gagatcctgtaccagcctgaaaagttcctgaattgcccagttctcattaagcagctcaca
aagatatactttaagtctccactaattctggctgtgaaaaatatctcccttgctatccaa
gagagggagtgctttggattacttggattcaatggagcaggtaaaacaactacctttcaa
attttgactggagaaattactcctaccgccggggatgtgttcattgatggcattagcatc
acaaaggatgtcctaaaggtcaggtcaaaaattggctattgtcctcaatttgatgctttg
ctggaatacctgaccggctgggaaataatggtcatgtatgcaagaatatggggaatctca
gagcgtcagattcggccctatgtgaacacgtacttgaattccttggaactggagcctcat
gccaacagtctcatcagcacctacagtgaaggaaacaaacgtaggctgagcactgccatt
gccatgatgggaaagccctcggttatcttcctggatgaaccatcaactggcatggaccca
agagctaggcgccttctctgggacgcagtgataaagattcgtgaaagtggaaaggccatc
attataacatcccacagcatggaagaatgtgaagcgctttgtacaaggctatccataatg
gtgcatgggaagctcacctgcctgggtagccctcagtacctcaagaacaagtttggtgat
atttatattctgaagaccaaggtcaagtctggggaaacattaaaggaatttaaaaatttc
atcacactgacatttccaggtagtgaattaaagcaagagaatcaagggatccttaattat
tacattcccagcaaggacaacagctggggaaaggtgtttggcattttggagaaagcgaag
gaacaatacgatttagaagactattccatcagtcagatcaccctggaccaagtcttcctg
gcttttgctgaccaagataggaagtga

DBGET integrated database retrieval system