KEGG   Rattus norvegicus (rat): 293454Help
Entry
293454            CDS       T01003                                 

Gene name
Ubfd1, RGD1306614, Ubph
Definition
(RefSeq) ubiquitin family domain containing 1
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif
Pfam: ubiquitin Ubiquitin_2 Ubiquitin_5 S-l_SbsC_C
Motif
Other DBs
NCBI-GeneID: 293454
NCBI-ProteinID: NP_001030083
RGD: 1306614
Ensembl: ENSRNOG00000018243
UniProt: Q3MIF1
Position
1q36
AA seq 309 aa AA seqDB search
MAAAGAPDGMEEPSMDTEAEAVATEAPARPLNCVEAEAVVGTAAEDSCDARGNLQPAPAQ
PPGDPAAQASVSNGEDAGGGAGRELVDLKIIWNKTKHDVKVPLDSTGSELKQKIHSITGL
PPAMQKVMYKGLVPEDKTLREIKVTSGAKIMVVGSTINDVLAVNTPKDAAQQDAKAEESK
KEPLCRQKQHRKVLDKGKPEDVMPSVKGAQERLPTVPLSGMYNKSGGKVRLTFKLEQDQL
WIGTKERTEKLPMGSIKNVVSEPIEGHEDYHMMAFQLGPTEASYYWVYWVPTQYVDAIKD
TVLGKWQYF
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atggcggcggccggagccccggatggcatggaggagccaagcatggacacggaggccgag
gctgtggccaccgaggcacccgcacggcccctcaactgcgtggaggccgaagcagtcgta
gggacagcggcggaggactcctgcgacgcgcgaggcaacctgcagccggccccggcccag
ccccctggggaccctgcggcccaggcctcggtcagcaacggtgaggacgcgggtggcggt
gcgggcagagagctggtggatctgaagataatctggaacaagaccaagcacgacgtgaag
gttcctctggacagcacgggttccgagctaaagcagaagattcactccattacaggtctc
ccacccgccatgcagaaagtcatgtataagggacttgttcctgaagacaagacgttgaga
gaaataaaagtgaccagtggggccaagatcatggtggttggctccactataaatgatgtt
ttagcagtaaacaccccaaaagatgctgcccagcaggatgcaaaggctgaagaaagcaag
aaggagcccctctgcaggcagaagcaacacaggaaagtgttggacaaaggaaaacctgaa
gatgtgatgccatctgttaagggtgcccaggagcgcctgccaacggtacccttgtctggc
atgtacaataagtctggagggaaagtgagactgacctttaagctagagcaagaccagctg
tggatcggcactaaagagcggactgagaaactgcccatgggctccattaaaaatgttgtc
agtgaacctattgaaggacatgaagactaccacatgatggcgtttcagttgggccccacg
gaagcctcttactactgggtgtactgggttccaactcaatatgtggatgcaatcaaagac
actgtgctgggcaagtggcagtatttttga

DBGET integrated database retrieval system