KEGG   Rattus norvegicus (rat): 293455
Entry
293455            CDS       T01003                                 

Gene name
Gga2
Definition
(RefSeq) ADP-ribosylation factor-binding protein GGA2
  KO
K12404  ADP-ribosylation factor-binding protein GGA
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04142  Lysosome
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    293455 (Gga2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    293455 (Gga2)
Membrane trafficking [BR:rno04131]
 Endosome - Golgi transport
  Others
   GGA
    293455 (Gga2)
SSDB
Motif
Pfam: VHS Alpha_adaptinC2 GGA_N-GAT GAT Csm1_N
Other DBs
NCBI-GeneID: 293455
NCBI-ProteinID: NP_001093989
RGD: 1304800
Ensembl: ENSRNOG00000018599
UniProt: G3V8F7 Q4G038
Position
1
AA seq 604 aa
MAATAVAAGTGSPAGTESAEGAPGSAAALELWLNKATNPSMAEQDWSAIQKFCEQVNTDP
SGPTHAPWLLAHKIQSPQEREALYALTVLEICMNHCGEKFHNEVAKFRFLNELIKVLSPK
YLGAWATEKVKGRVIEILFSWTVWFPEDIKIRDAYQMLKKQGIIKQDPKLPMDKILPPPS
PWPKSIFDADEEKSKLLTRLLKSNHPEDLQAANRLIKNLVKEEQEKSEKVSRRVSAVEEV
RSHVRVLREMLSMYRRPGHALPDQQALQVVYERCEKLRPTLFRLASDTTDDDDALAEILQ
ANDLLTQGVLLYKQVVEGRVNAGNAVPAAVGAIPASRVFPSPEPCGKNCPLIDLEAPSLL
HQDLAALGINDVPTRNQVVIPSCCKDKKQPGAITLMGGGIQSLSADRNLLDLFSPQPSPG
PLNYVPQKSIPKEVPPGTKASPGWSWEAGPLASSPASQNTPLAHVFVPLESVKPSSLPPI
IVYDRNGFRILLHFSQTGAPGHPDVQVLLLTMMSTATQPVWDVMFQVAVPKSMRVKLQPA
SSSKLPAFSPLTPPAVISQMLLLDNPHKEPIRLRYKLTFNQGGQPFSEVGEVKDFPDLAV
LSTA
NT seq 1815 nt   +upstreamnt  +downstreamnt
atggcagcgacggctgtggcggcggggaccggatcccccgcagggaccgagtcggcggag
ggcgcccctggctcagcggcggcactggagctgtggctcaacaaagccacaaacccaagt
atggcagagcaggattggtcagccatccagaagttctgtgagcaggtgaacaccgacccc
agtggcccaacacatgcgccctggctactggcccacaagatccagtctccacaggagagg
gaagctctttacgccctgacggtgttggagatatgcatgaaccactgcggggagaagttc
cacaatgaagtggccaagtttcgcttcctgaatgaactgatcaaagtattgtccccaaag
tacctaggggcctgggctacggagaaggttaaaggaagagttattgaaatcctctttagc
tggacagtctggtttccggaagacatcaagatccgagatgcttatcagatgctgaagaag
caaggaatcataaagcaagaccctaaactaccgatggataagatcctgccgccaccgtcc
ccctggccgaagagcatctttgatgctgatgaggaaaagtcaaagcttctgacaagactt
ctcaagagcaaccaccccgaggatcttcaggctgcaaaccggctgatcaagaatttggtc
aaggaggaacaagaaaagtcagaaaaggtgtccaggcgagtcagtgcggtagaggaagtc
cgcagccacgtgagagtgctgcgggagatgctgagcatgtaccgaaggccaggccatgcc
ctgcctgaccagcaggccctgcaggttgtctatgaaagatgtgagaagcttcggcccact
ctgttccggcttgcaagcgacaccactgatgacgacgatgcactggcggagattcttcaa
gcaaatgaccttctcacccaaggggttctgctgtacaaacaggtggtggaaggccgagtc
aatgccgggaatgcagtgcccgccgcagtgggagccattcctgcttccagagtgttcccg
agtccagaaccctgtgggaagaactgccccctcattgacctggaggcaccatctttgctt
catcaggacctggcggccttagggatcaacgatgttcccactaggaaccaggttgtcatt
ccaagttgctgtaaggacaagaagcagcctggtgccatcacactcatggggggtggaatc
cagagtctttctgcagaccggaacttgctggatctcttctcgccacagccgtctccagga
ccactgaattacgttccacaaaaaagcatccccaaggaggtgccaccaggtaccaaggcc
tctccaggttggtcctgggaggctgggccattggcttcttccccagcctcacagaataca
cctctggctcacgtgtttgtccctttggagtctgtgaagcccagcagcctgccgcccatc
atcgtgtatgaccggaacggcttccgaattctgctgcacttctcccagacgggggcccct
ggccacccggatgtgcaggtgttgctgttgaccatgatgagcactgccacccagcctgtc
tgggacgtcatgtttcaggtggctgtcccaaagtcgatgcgagtgaagctgcagccagca
tccagttccaagctcccagcattcagtcctttgacgcctccagccgtgatctctcagatg
ctgttgctcgacaacccacacaaagaacctatccggttgcggtacaagctgactttcaac
caaggcgggcagccgttcagtgaagtaggagaggtgaaagactttccagacctggccgtc
ttgagcaccgcctga

KEGG   Rattus norvegicus (rat): 300066
Entry
300066            CDS       T01003                                 

Gene name
Gga1
Definition
(RefSeq) ADP-ribosylation factor-binding protein GGA1
  KO
K12404  ADP-ribosylation factor-binding protein GGA
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04142  Lysosome
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    300066 (Gga1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    300066 (Gga1)
Membrane trafficking [BR:rno04131]
 Endosome - Golgi transport
  Others
   GGA
    300066 (Gga1)
SSDB
Motif
Pfam: Alpha_adaptinC2 GAT GGA_N-GAT VHS Elf4 ATG17_like AP3B1_C Ferritin DUF484 RsbU_N RasGEF_N_2 DUF3450 ISG65-75
Other DBs
NCBI-GeneID: 300066
NCBI-ProteinID: NP_001011994
RGD: 1307770
Ensembl: ENSRNOG00000008897
UniProt: Q5FVF3
Position
7
AA seq 562 aa
MKSCGKRFHDEVGKFRFLNELIKVVSPKYLGSRTSEKVKNKILELLYSWTVGLPEEVKIA
EAYQMLKKQGIVKSDPKLPEDAIFPLPPPRPKNVIFEDEEKSKMLARLLKSSHPEDLRAA
NKLIKEMVQEDQKRMEKISKRVNAIEEVNNNVKLLTEMVMSHSQGAASSSSEDLMKELYQ
RCERMRPTLFRLASDTEDNDEALAEILQANDNLTQVINLYKQLVRGEELNGEATAGSIPG
STSALLDLSGLDLPSSGTTYPATPTRPGNQNSPEQLSASVSLLDDELMSLGLSDPTPPSA
PSSDSVGWNGFQSSDGTEPSVPPPAQAPCMDSRPPAQASPPTSSGLDDLDLLGKTLMQQA
LPPEAQQVRWEKQQPAPRLTLRDLQSKSSSPNPGATSLLHTTSPEPPGPQPQAIPTELSL
TNITVPLESIKPSSILPVTVYDQHGFRVLFHFARDPLPGRSDVLVVVVSMLSTAPQPIRN
IVFQSAVPKVMKVRLQPPSGTELPAFNPIVHPSAITQVLLLANPQKEKVRLRYKLIFTMG
DQTYNEMGDVDQFPPPETWGSL
NT seq 1689 nt   +upstreamnt  +downstreamnt
atgaagagctgtggcaagaggttccatgacgaagtgggcaagttccgcttcctgaatgag
ctcatcaaggttgtgtctcccaagtacttgggctcccggacatcagagaaggtgaagaat
aagatcttggagctgctgtacagctggacagtcggcctccctgaggaggtgaagattgcc
gaagcctaccagatgctgaagaagcaggggatcgtgaagtctgaccccaagcttccagag
gatgccatctttcccctcccccctccccggcccaagaatgtgatctttgaagatgaggag
aagtccaagatgctggcccgccttctgaagagctcacaccccgaagacctccgggctgcc
aataagctcatcaaagagatggtgcaggaggaccagaagcggatggagaagatctcaaag
cgggtaaatgccattgaggaggtcaacaacaatgtgaagctgctgacagagatggtgatg
agccacagccagggtgctgcatccagcagcagtgaggacctcatgaaggaactgtaccag
cgctgtgagcgcatgcggcccacactcttccgactggccagtgacacagaagacaatgat
gaggccttagctgagatcctgcaggctaacgacaatctcacccaggtgatcaacctgtac
aagcagctggtccggggtgaggagctcaatggtgaagccacagccggctccattcctgga
agcacctcagccctgctggacctctcaggcctggacctcccttcctccggcaccacatac
ccagccacgcccactcgccctggcaaccagaacagtccagagcaactgagtgcctcagtg
tccttgctcgatgatgagctcatgtctttgggcctaagtgaccccacaccaccttcagct
cccagctcagatagtgtcgggtggaacggcttccagtcatcagatggcactgaaccctca
gtccctcctccagcccaggccccctgcatggacagccgacccccagcccaggcatcccca
ccaacgagcagcggcctggatgacctggacctcttggggaaaacccttatgcaacaggca
ctgcccccggaagcccagcaagtgcggtgggagaagcagcagccagccccccggctcacc
ctccgtgacctgcagagcaagagcagctcgcccaatccaggagccaccagcctcctccac
accacgtccccagagccccctgggcctcagcctcaggccatacccactgagctctcctta
accaacatcactgtgcccttggagtctatcaaacccagcagcatcttgccagtgaccgtt
tatgaccagcatggcttccgtgtcctcttccattttgctcgcgacccactgcccggacgc
tctgatgtgctggtggtggtggtctctatgctgagcacggctccccagcccatccgaaac
attgttttccagtcagctgtccccaaggtcatgaaggtgaggctgcagccaccctccggc
acagagctgccagcatttaaccccatcgtccacccctccgccatcacccaggtcctgctc
cttgctaacccccagaaggagaaggtccgcctccgctacaagctcatcttcactatgggt
gaccagacctacaatgagatgggagatgtggatcagttccccccaccagaaacctgggga
agcctctag

KEGG   Rattus norvegicus (rat): 360658
Entry
360658            CDS       T01003                                 

Gene name
Gga3
Definition
(RefSeq) ADP-ribosylation factor-binding protein GGA3
  KO
K12404  ADP-ribosylation factor-binding protein GGA
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04142  Lysosome
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    360658 (Gga3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    360658 (Gga3)
Membrane trafficking [BR:rno04131]
 Endosome - Golgi transport
  Others
   GGA
    360658 (Gga3)
SSDB
Motif
Pfam: VHS Alpha_adaptinC2 GGA_N-GAT GAT HD_2 SesA HBM DUF3891 DUF1722
Other DBs
NCBI-GeneID: 360658
NCBI-ProteinID: NP_001101774
RGD: 1309553
Ensembl: ENSRNOG00000027057
UniProt: D3ZHG8
Position
10
AA seq 658 aa
MAEAEGESLESWLNKATNPSNRQEDWEYIIGFCDQINKELEGPQIAVRLLAHKIQSPQEW
EAVQALTVLEACMKNCGRRLHNEVGKFRFLNELIKVVSPKYLGDRVSEKVKAKVIELLFS
WTLALPEEAKIKDAYHMLKRQGIVQSDPPIPMDRTLIPSPPPRPKNPVFDDEEKSKLLAK
LLRSKNPDDLQEANQLIKSMVKEDEARIQKVTKRLHTLEEVNNNVKLLHEMLLHYSQEFS
SEADKELMKELFDRCENKRRTLFKLASETEDNDNSLGDILQASDNLSRVINSYKTIIEGQ
IINGEVTTSTVPDSEGNSHCGNQGALIDLAELDTPSSSSPVLAPAPAPPTSGIPILPPPP
QTSGPPRSRSSSQAEAPSGPDSTNNALSLLDEELLCLAPVVPASAVTHSTGSFTFSSGPA
PALVPKAEPEGPEYPSSSISHRLDALDQLLEEAKVTSGLVKPVSCFSPGPTASPLLPAST
PARPLLPFSTGPGSPLFQSPAFQSQGSPQKGPELSLASVHVPLESIKPSSALPVTAYDKN
GFRILFHFAKECPPGRPDVLVVVVSMLNTAPLPVKSIVLQAAVPKSMKVKLQPPSGTELS
PFSPIQPPAAITQVMLLANPMKEKVRLRYKLTFALGEQLSTELGEVDQFPPVEQWGNL
NT seq 1977 nt   +upstreamnt  +downstreamnt
atggcggaggcggaaggggagagcctggaatcctggctgaataaagctaccaatccttcc
aaccgccaggaagactgggaatacatcattggcttctgtgatcagatcaacaaagagctt
gaagggccccagattgctgtgcgactcctggctcacaagatccagtctccacaggaatgg
gaggcagtgcaggccctcacggtgctggaggcgtgtatgaagaattgcggcaggagactt
cataatgaagtgggaaagttccgatttttgaatgaattaatcaaagtcgtctctccaaag
tacttgggagacagggtgtctgaaaaggtgaaggctaaggtcatcgagttgctttttagc
tggacactggccttgccggaagaagcaaagatcaaagacgcctaccatatgttgaagaga
caaggcatagtgcagtcggacccccctatccccatggacagaacactgatcccctctcct
ccacctcgtcccaaaaaccctgtttttgatgatgaggaaaaatccaagctcttagccaag
ctgctgagaagcaagaacccagatgacttacaagaagccaaccaactcatcaagtccatg
gtgaaggaagatgaggcgcgcatccagaaagtgaccaagcgcctacacacgttggaggaa
gttaacaacaatgtcaagctgctccatgagatgcttcttcactacagccaagagttctca
tcagaggccgacaaagagctcatgaaggagctctttgatcgttgtgagaataagagacgg
acattatttaaactagccagtgagacagaagacaatgacaatagtttgggggacatcctg
caggccagtgacaacctgtccagggtcatcaactcttacaaaacaattattgaagggcag
atcatcaatggtgaggtgaccacctcaaccgtgcctgactctgaaggaaatagtcactgc
ggtaaccaaggcgccctcatcgaccttgccgagttggacacccccagcagctcatcccca
gtgttggccccagcacctgccccacccacctcaggcatccctatccttcccccacctccc
caaacctccgggcctccacgaagccgttcatccagccaggctgaggctccctcagggcct
gacagcacgaacaatgccctctccttgctggatgaggagctcctctgtctagctcctgtg
gtcccagcgagcgcagtgacccacagcactggttcctttacgttctcttctggacctgcc
ccagccttggttccaaaggctgagcccgaaggcccagagtaccccagctccagcatctca
caccgcctggatgcccttgatcagcttctggaagaggccaaagtgacttcaggcctggtg
aaacctgtttcttgcttctctcctgggcccaccgcctccccactgcttcctgcctctacc
ccagccaggcctctcctgcccttctcaactgggcccggaagtcctctcttccagtcgcca
gccttccagtcccaaggcagccctcagaagggcccagagctctccctggctagtgtccat
gtgcccctggaatcgatcaagcctagcagtgcccttcctgtgacagcctatgataaaaat
ggcttccgcatccttttccactttgctaaggagtgtccgccaggacggcctgatgtgctg
gtggtggtggtttccatgctgaatacagctcccttgccagtcaagagtatagtgctacag
gccgcagtgcccaagtcaatgaaagtgaagttgcagccaccctctgggacagaactttct
ccatttagtcccatccagccacctgcagccatcacccaggtcatgctgctggccaatcca
atgaaggaaaaggtacggcttcggtataaattgacctttgctctgggggagcagctgagc
acagagctgggtgaagtggaccagtttcctcctgtggagcagtgggggaacctatga

DBGET integrated database retrieval system