KEGG   Rattus norvegicus (rat): 293485
Entry
293485            CDS       T01003                                 

Gene name
Cln3
Definition
(RefSeq) battenin
  KO
K12389  battenin
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04142  Lysosome
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    293485 (Cln3)
SSDB
Motif
Pfam: CLN3
Other DBs
NCBI-GeneID: 293485
NCBI-ProteinID: NP_001006972
RGD: 1359537
Ensembl: ENSRNOG00000019103
UniProt: Q5XIH8
Position
1
AA seq 438 aa
MGSSESSWRRLEDSEREETDSEPQTPPLDNLSVLWKNAVGFWILGLCNNFSYVVMLSAAH
DILKQEQASGNQSHVEPGPTPMPHNSSSRFDCNSISTAAVLLADILPTLVIKLLAPLGLH
LLPYSPRVLVSGVCSAGSFVLVAFSQSVGLSLCGVVLASISSGLGEVTFLSLTAFYPSAV
ISWWSSGTGGAGLLGSLSYLGLTQAGLSPQHTLLSMLGIPVLMLASYFLLLTSPEPLDPG
GQDEAETAARQPLIGTETPESRPGTSWDLSLQERWTVFKGLLRYIIPLVLVYFAEYFINQ
GLFELLFFRNTSLSHAQQYRWYQMLYQAGVFASRSSLQCCRIRFTWILALLQCLNLAFLL
ADVCLTFLPSIYLIFIVILYEGLLGGAAYVNTFHNIALETSDKHREFAMEAACISDTLGI
SLSGVLALPLHDFLCHLP
NT seq 1317 nt   +upstreamnt  +downstreamnt
atgggaagctctgagagctcgtggaggcgccttgaggattctgagagggaggagaccgac
tcagagccccaaacccctccgttggataatctaagtgtcctttggaagaatgcggtgggc
ttctggatcttggggctttgcaacaacttctcatatgtggtgatgctgagcgctgcccat
gacatccttaagcaggagcaggcatctggaaaccagagccatgtggaaccaggcccaaca
cccatgccccataacagctcatctcgatttgattgcaattcaatctccacagctgcggtg
ctcctagcagacatccttcccacccttgtcatcaaactcctggctcctcttggccttcat
ttgctgccttacagcccccgggtgcttgtcagtggagtctgttctgctggaagctttgtt
ctggttgccttttctcaatcagtggggttaagcctgtgtggagtggttttggccagcatc
tcatcaggtctaggggaggtcaccttcctttcactgactgccttctaccccagtgctgtg
atctcatggtggtcttcaggaactgggggtgcagggcttcttggatcgctgtcatacctg
gggctcacccaggctggcctctccccgcagcacaccctactttctatgctggggatccct
gttctgatgctagccagctatttcttgctgctcacatctcctgaacccctggaccctgga
gggcaagacgaggcagagactgctgcccggcagcctctcataggcaccgagaccccagag
tctaggccaggtaccagctgggacctctctctccaggaaaggtggacagtgttcaagggc
ctcttgcgatacatcatccctctggtgctggtctactttgcagaatactttatcaaccag
gggctttttgagctcctgtttttccggaacacatccttaagtcatgctcagcagtaccga
tggtaccagatgctataccaggctggtgtgttcgcttcccgctcttctctccagtgttgc
cgaatccggttcacctggatcctagccctgctccagtgcctcaacctggccttcctgctg
gcagatgtatgcttgaccttcctgcccagcatctacctcatcttcatcgtcattctgtat
gaagggcttctgggcggggccgcttacgtgaataccttccacaacattgccctggagacc
agtgacaagcaccgagagtttgccatggaagctgcctgcatttctgacaccttgggaatc
tccctgtcaggggtcctggccttgcctctgcatgacttcctctgccacctcccctga

DBGET integrated database retrieval system