KEGG   Rattus norvegicus (rat): 29349Help
Entry
29349             CDS       T01003                                 

Gene name
Fgf8
Definition
(RefSeq) fibroblast growth factor 8
  KO
K04358  fibroblast growth factor
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04010  MAPK signaling pathway
rno04014  Ras signaling pathway
rno04015  Rap1 signaling pathway
rno04151  PI3K-Akt signaling pathway
rno04810  Regulation of actin cytoskeleton
rno05200  Pathways in cancer
rno05218  Melanoma
rno05224  Breast cancer
rno05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    29349 (Fgf8)
   04015 Rap1 signaling pathway
    29349 (Fgf8)
   04010 MAPK signaling pathway
    29349 (Fgf8)
   04151 PI3K-Akt signaling pathway
    29349 (Fgf8)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    29349 (Fgf8)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    29349 (Fgf8)
  09162 Cancer: specific types
   05226 Gastric cancer
    29349 (Fgf8)
   05218 Melanoma
    29349 (Fgf8)
   05224 Breast cancer
    29349 (Fgf8)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:rno04052]
    29349 (Fgf8)
   00536 Glycosaminoglycan binding proteins [BR:rno00536]
    29349 (Fgf8)
Cytokines and growth factors [BR:rno04052]
 Growth factors
  Growth factors (RTK binding)
   29349 (Fgf8)
Glycosaminoglycan binding proteins [BR:rno00536]
 Heparan sulfate/Haparin
  Growth factors/receptors
   29349 (Fgf8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FGF Fascin FRG1
Motif
Other DBs
NCBI-GeneID: 29349
NCBI-ProteinID: NP_579820
RGD: 70891
Ensembl: ENSRNOG00000017524
UniProt: Q76LI5
Position
1q54
AA seq 204 aa AA seqDB search
MGSPRSALSCLLLHLLVLCLQAQHVREQSLVTDQLSRRLIRTYQLYSRTSGKHVQVLANK
RINAMAEDGDPFAKLIVETDTFGSRVRVRGAETGLYICMNKKGKLIAKSNGKGKDCVFTE
IVLENNYTALQNAKYEGWYMAFTRKGRPRKGSKTRQHQREVHFMKRLPRGHHTTEQSLRF
EFLNYPPFTRSLRGSQRTWAPEPR
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atgggcagcccccgctccgcgctgagctgcctgctgttgcacttgctggttctctgcctc
caagcccagcatgtgagggagcagagcctggtgacggatcagctcagccgccgcctcatc
cggacctaccagctctacagccgcaccagcgggaagcacgtgcaggtcctggccaacaag
cgcatcaacgccatggcagaagacggagaccccttcgcaaagctcattgtggagaccgat
acttttggaagcagagtccgagtccgcggagcagagaccggtctgtacatctgcatgaac
aagaaggggaagctaatcgccaagagcaacggcaaaggcaaggactgcgtgttcacggag
atcgtgctggagaacaactacacggcgctgcagaacgccaagtacgagggctggtacatg
gcctttacccgcaagggccggccccgcaagggttccaagacgcgccagcaccagcgcgag
gtgcacttcatgaagcgcctgccgcggggccaccacaccacagagcagagcctccgcttc
gagttcctcaactacccgcccttcacgcgcagcctgcgcggcagccagaggacttgggcc
ccggagccccgatag

DBGET integrated database retrieval system