KEGG   Rattus norvegicus (rat): 293498
Entry
293498            CDS       T01003                                 

Gene name
Asphd1, RGD1306636
Definition
(RefSeq) aspartate beta-hydroxylase domain containing 1
Organism
rno  Rattus norvegicus (rat)
SSDB
Motif
Pfam: Asp_Arg_Hydrox
Other DBs
NCBI-GeneID: 293498
NCBI-ProteinID: XP_001078017
RGD: 1306636
Ensembl: ENSRNOG00000027213
UniProt: D3ZWE1
Position
1q37
AA seq 360 aa
MWKGGNQEAVIEGSGGELGGPGSWGLQDAAGLLARASLPIMFPWPLPLGSSVLTVLLGAL
TSLFLWYCYRLGSQDMQALGIGSRAGGVSGMPDVCSQTGSRGSGDPGEGHRAEGLVSRRL
RAYARRYSWAGMGRVRRAAQGGPGLTGGTGILGIQRPGLLFLPDLPSSPFVPRDAQRHDV
ELLQSSFPAILRDFGAVSWDFSGSTPLPRGWSPPLAPGCYQLLLYQAGRCQPSNCRRCPG
AYRALRGLRSFMSANTFGNAGFSVLLPGARLEGRCGPTNARVRCHLGLKIPPGCELVVGG
EPQCWAEGHCLLVDDSFLHTVAHNGSPEDGPRVVFIVDLWHPNVAGAERQALDFVFAPDP
NT seq 1083 nt   +upstreamnt  +downstreamnt
atgtggaagggagggaatcaggaagcagtcattgaggggtcaggtggagaactgggggga
ccagggagctggggtctacaagatgcagcaggcctcttagccagagcctctttgcctatc
atgtttccatggccactgcccctaggttcctcagttcttactgtgctcctcggagccctc
acttctctgttcctttggtactgctaccgcctgggctcccaagacatgcaggccctgggg
attgggagcagagctgggggtgttagtggtatgcctgatgtatgctctcagactggctca
cggggctctggggatcctggggaaggacacagggcagaaggtctagtgagcaggcggctt
cgggcctatgccaggcgttactcctgggctggaatgggcagagtgaggcgggcagctcag
ggtggccctggcctcacaggagggacagggatactgggcattcagcgccctggcttactt
ttcctaccagacctgccttcatccccctttgtgccacgtgatgcccagaggcatgatgtg
gagctcctacagagcagcttccccgccattttgcgggacttcggagctgtgagctgggac
ttctcagggagtacccctctgcctcggggctggtccccacccttggcccctgggtgctac
cagctcctgctgtaccaagcaggccggtgccaacccagcaactgccggcggtgcccagga
gcctatcgggcactgagagggctgcggagcttcatgagtgccaataccttcggcaatgct
ggcttttccgttctactgcctggggcccggcttgagggccgctgtggacccaccaatgct
cgagttagatgccatctgggtctgaagatccctcctggttgtgagctggttgttggtggt
gagccccagtgttgggctgaagggcactgcctcctggtggacgactccttcctgcataca
gtggctcataatggatcccctgaagatgggcctcgagtggtcttcatcgtggatctctgg
caccctaacgtggctggggctgaacgccaagctcttgactttgtcttcgcaccagaccct
tga

DBGET integrated database retrieval system