KEGG   Rattus norvegicus (rat): 293508Help
Entry
293508            CDS       T01003                                 

Gene name
Prkacb
Definition
(RefSeq) protein kinase cAMP-activated catalytic subunit beta
  KO
K04345  protein kinase A [EC:2.7.11.11]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno01522  Endocrine resistance
rno04010  MAPK signaling pathway
rno04014  Ras signaling pathway
rno04020  Calcium signaling pathway
rno04024  cAMP signaling pathway
rno04062  Chemokine signaling pathway
rno04114  Oocyte meiosis
rno04140  Autophagy - animal
rno04211  Longevity regulating pathway
rno04213  Longevity regulating pathway - multiple species
rno04261  Adrenergic signaling in cardiomyocytes
rno04270  Vascular smooth muscle contraction
rno04310  Wnt signaling pathway
rno04340  Hedgehog signaling pathway
rno04371  Apelin signaling pathway
rno04530  Tight junction
rno04540  Gap junction
rno04611  Platelet activation
rno04713  Circadian entrainment
rno04714  Thermogenesis
rno04720  Long-term potentiation
rno04723  Retrograde endocannabinoid signaling
rno04724  Glutamatergic synapse
rno04725  Cholinergic synapse
rno04726  Serotonergic synapse
rno04727  GABAergic synapse
rno04728  Dopaminergic synapse
rno04740  Olfactory transduction
rno04742  Taste transduction
rno04750  Inflammatory mediator regulation of TRP channels
rno04910  Insulin signaling pathway
rno04911  Insulin secretion
rno04912  GnRH signaling pathway
rno04913  Ovarian steroidogenesis
rno04914  Progesterone-mediated oocyte maturation
rno04915  Estrogen signaling pathway
rno04916  Melanogenesis
rno04918  Thyroid hormone synthesis
rno04919  Thyroid hormone signaling pathway
rno04921  Oxytocin signaling pathway
rno04922  Glucagon signaling pathway
rno04923  Regulation of lipolysis in adipocytes
rno04924  Renin secretion
rno04925  Aldosterone synthesis and secretion
rno04926  Relaxin signaling pathway
rno04927  Cortisol synthesis and secretion
rno04928  Parathyroid hormone synthesis, secretion and action
rno04934  Cushing's syndrome
rno04961  Endocrine and other factor-regulated calcium reabsorption
rno04962  Vasopressin-regulated water reabsorption
rno04970  Salivary secretion
rno04971  Gastric acid secretion
rno04976  Bile secretion
rno05012  Parkinson's disease
rno05020  Prion diseases
rno05030  Cocaine addiction
rno05031  Amphetamine addiction
rno05032  Morphine addiction
rno05146  Amoebiasis
rno05165  Human papillomavirus infection
rno05166  HTLV-I infection
rno05169  Epstein-Barr virus infection
rno05200  Pathways in cancer
rno05203  Viral carcinogenesis
rno05205  Proteoglycans in cancer
rno05414  Dilated cardiomyopathy (DCM)
Module
rno_M00695  cAMP signaling
Brite
KEGG Orthology (KO) [BR:rno00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    293508 (Prkacb)
   04010 MAPK signaling pathway
    293508 (Prkacb)
   04310 Wnt signaling pathway
    293508 (Prkacb)
   04340 Hedgehog signaling pathway
    293508 (Prkacb)
   04371 Apelin signaling pathway
    293508 (Prkacb)
   04020 Calcium signaling pathway
    293508 (Prkacb)
   04024 cAMP signaling pathway
    293508 (Prkacb)
 Cellular Processes
  Transport and catabolism
   04140 Autophagy - animal
    293508 (Prkacb)
  Cell growth and death
   04114 Oocyte meiosis
    293508 (Prkacb)
  Cellular community - eukaryotes
   04530 Tight junction
    293508 (Prkacb)
   04540 Gap junction
    293508 (Prkacb)
 Organismal Systems
  Immune system
   04611 Platelet activation
    293508 (Prkacb)
   04062 Chemokine signaling pathway
    293508 (Prkacb)
  Endocrine system
   04911 Insulin secretion
    293508 (Prkacb)
   04910 Insulin signaling pathway
    293508 (Prkacb)
   04922 Glucagon signaling pathway
    293508 (Prkacb)
   04923 Regulation of lipolysis in adipocyte
    293508 (Prkacb)
   04912 GnRH signaling pathway
    293508 (Prkacb)
   04913 Ovarian Steroidogenesis
    293508 (Prkacb)
   04915 Estrogen signaling pathway
    293508 (Prkacb)
   04914 Progesterone-mediated oocyte maturation
    293508 (Prkacb)
   04921 Oxytocin signaling pathway
    293508 (Prkacb)
   04926 Relaxin signaling pathway
    293508 (Prkacb)
   04918 Thyroid hormone synthesis
    293508 (Prkacb)
   04919 Thyroid hormone signaling pathway
    293508 (Prkacb)
   04928 Parathyroid hormone synthesis, secretion and action
    293508 (Prkacb)
   04916 Melanogenesis
    293508 (Prkacb)
   04924 Renin secretion
    293508 (Prkacb)
   04925 Aldosterone synthesis and secretion
    293508 (Prkacb)
   04927 Cortisol synthesis and secretion
    293508 (Prkacb)
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    293508 (Prkacb)
   04270 Vascular smooth muscle contraction
    293508 (Prkacb)
  Digestive system
   04970 Salivary secretion
    293508 (Prkacb)
   04971 Gastric acid secretion
    293508 (Prkacb)
   04976 Bile secretion
    293508 (Prkacb)
  Excretory system
   04962 Vasopressin-regulated water reabsorption
    293508 (Prkacb)
   04961 Endocrine and other factor-regulated calcium reabsorption
    293508 (Prkacb)
  Nervous system
   04724 Glutamatergic synapse
    293508 (Prkacb)
   04727 GABAergic synapse
    293508 (Prkacb)
   04725 Cholinergic synapse
    293508 (Prkacb)
   04728 Dopaminergic synapse
    293508 (Prkacb)
   04726 Serotonergic synapse
    293508 (Prkacb)
   04720 Long-term potentiation
    293508 (Prkacb)
   04723 Retrograde endocannabinoid signaling
    293508 (Prkacb)
  Sensory system
   04740 Olfactory transduction
    293508 (Prkacb)
   04742 Taste transduction
    293508 (Prkacb)
   04750 Inflammatory mediator regulation of TRP channels
    293508 (Prkacb)
  Aging
   04211 Longevity regulating pathway - mammal
    293508 (Prkacb)
   04213 Longevity regulating pathway - multiple species
    293508 (Prkacb)
  Environmental adaptation
   04713 Circadian entrainment
    293508 (Prkacb)
   04714 Thermogenesis
    293508 (Prkacb)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    293508 (Prkacb)
   05205 Proteoglycans in cancer
    293508 (Prkacb)
   05203 Viral carcinogenesis
    293508 (Prkacb)
  Neurodegenerative diseases
   05012 Parkinson's disease
    293508 (Prkacb)
   05020 Prion diseases
    293508 (Prkacb)
  Substance dependence
   05030 Cocaine addiction
    293508 (Prkacb)
   05031 Amphetamine addiction
    293508 (Prkacb)
   05032 Morphine addiction
    293508 (Prkacb)
  Cardiovascular diseases
   05414 Dilated cardiomyopathy (DCM)
    293508 (Prkacb)
  Endocrine and metabolic diseases
   04934 Cushing's syndrome
    293508 (Prkacb)
  Infectious diseases
   05166 HTLV-I infection
    293508 (Prkacb)
   05169 Epstein-Barr virus infection
    293508 (Prkacb)
   05165 Human papillomavirus infection
    293508 (Prkacb)
   05146 Amoebiasis
    293508 (Prkacb)
  Drug resistance
   01522 Endocrine resistance
    293508 (Prkacb)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     293508 (Prkacb)
Protein kinases [BR:rno01001]
 Serine/threonine kinases: AGC group
  PKA family
   293508 (Prkacb)
Messenger RNA biogenesis [BR:rno03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     293508 (Prkacb)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    293508 (Prkacb)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Haspin_kinase
Motif
Other DBs
NCBI-GeneID: 293508
NCBI-ProteinID: NP_001071113
RGD: 1310574
Ensembl: ENSRNOG00000004978
UniProt: P68182
Position
2q44
AA seq 351 aa AA seqDB search
MGNTAIAKKGSEVESVKEFLAKAKEDFLRKWENPPPSNAGLEDFERKKTLGTGSFGRVML
VKHKATEQYYAMKILDKQKVVKLKQIEHTLNEKRILQAVEFPFLVRLEYSFKDNSNLYMV
MEYVPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDHQGY
IQVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFF
ADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVSDIKTHKWFAT
TDWIAIYQRKVEAPFIPKFRGSGDTSNFDDYEEEEIRVSITEKCGKEFCEF
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atggggaacacggcgatcgccaagaaaggcagcgaagtggagagcgtgaaagaattccta
gccaaagccaaagaagactttctgaggaaatgggagaaccctcccccgagtaatgctggg
cttgaggattttgaaaggaaaaaaacccttggaacgggttccttcggaagagtcatgctg
gtaaagcataaagccactgagcagtactacgccatgaagatcttagacaagcagaaggtc
gttaagctaaagcaaatagagcacactctgaatgagaagagaatcctgcaggcagtggag
ttcccgttccttgttcggctggagtattcttttaaggataattctaatttatacatggtt
atggaatacgttcctgggggggaaatgttttcacatctaagaagaattggaaggttcagt
gaaccccatgctcgtttctatgcagctcagatcgtgctaacatttgagtacctccattcc
ctcgacctcatctacagagatctcaagccggaaaacctcttaattgaccaccagggttac
atccaggtcacagattttgggttcgccaagagagtcaagggcaggacttggacattgtgt
ggcaccccagagtacctggccccagagatcatcctcagcaagggttacaataaggcagtg
gactggtgggcattgggtgtactgatctacgagatggctgctggctaccccccgttcttt
gctgaccagccaattcagatttatgagaagattgtttccggaaaggtccgcttcccgtcg
cacttcagttccgatctcaaggaccttctgcggaatctgctgcaggtggatctgacaaag
cggtttgggaacctgaagaatggcgtgagtgacatcaagacccacaagtggtttgctacg
accgactggatcgcgatttaccagagaaaggttgaggctccattcataccaaaattcaga
ggctctggcgataccagcaacttcgatgactatgaagaagaagaaatccgagtgtctata
acagaaaaatgtggaaaggagttttgtgaattttag

DBGET integrated database retrieval system