KEGG   Rattus norvegicus (rat): 293537Help
Entry
293537            CDS       T01003                                 

Gene name
Hmx3, RGD1559927
Definition
(RefSeq) H6 family homeobox 3
  KO
K09349  homeobox protein Nkx-5
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rno03000]
    293537 (Hmx3)
Transcription factors [BR:rno03000]
 Eukaryotic Type
  Helix-turn-helix
   Homeo domain only, NK-2
    293537 (Hmx3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Homeodomain
Motif
Other DBs
NCBI-GeneID: 293537
NCBI-ProteinID: NP_001099772
RGD: 1559927
Ensembl: ENSRNOG00000020637
UniProt: D4A585
Position
1q41
AA seq 356 aa AA seqDB search
MPEPGPDASGTASAPPPQPPPQPPAPKESPFSIRNLLNGDHHRPPPKPQPPPRTLFAPAS
AAAAAAAAAAAAAKGALEGAAGFALSQVGDLAFPRFEIPAQRFALPAHYLERSPAWWYPY
TLTPAGGHLPRPEASEKALLRDSSPASGTDRDSPDPLLKADPDHKELDSKSPDEIILEES
DSEEGKKEGEAVPGAAGTTVGATAATPGSEDWKAGADSPEKKPACRKKKTRTVFSRSQVF
QLESTFDMKRYLSSSERAGLAASLHLTETQVKIWFQNRRNKWKRQLAAELEAANLSHAAA
QRIVRVPILYHENSAAEGAAAAAGAPVPVSQPLLTFPHPVYYSHPVVSSVPLLRPV
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atgccggagcccgggccggacgcctcgggcactgccagcgcgccgcccccgcagcctcct
ccccagcctcccgcgcccaaggaatccccgttctccatcaggaacctgctcaacggagac
catcaccggccgcccccgaagccacagccgcccccacgaacgctctttgcgccggcctcg
gccgccgccgctgcggccgccgctgccgccgccgcagccaaaggtgccctggagggtgcc
gcgggcttcgcgctctcgcaggtgggagacctggccttcccccgctttgagatcccagcg
cagaggtttgcattgcccgcgcactacctggagcgctccccggcctggtggtacccctac
accctgacccccgccggcggccacctcccgcgaccagaagcctctgagaaggccctcctg
cgcgattcctcccctgcgtccggcacagaccgcgactccccggaccctctgctcaaggct
gaccccgaccacaaggagctggactccaagagcccggacgagatcattctggaagagagc
gactcggaggaaggcaaaaaagaaggcgaggcggtgcctggcgcggccgggacgacagta
ggggcgactgcggcgacaccgggctcagaggactggaaggcgggcgccgacagtcccgag
aagaagccggcgtgccgcaaaaagaagacgcgcaccgtcttctcccgcagccaggtcttc
cagctcgagtccaccttcgacatgaagcgctacctgagcagctcggagcgcgccggcctg
gccgcgtcgcttcacctcaccgagacgcaggtcaagatctggttccagaatcgccgcaac
aagtggaagcgacagctggcggccgagctggaggcggccaacctgagccacgccgctgcg
cagcgcatcgtgcgcgtgcccatcctctaccacgagaactctgcggccgagggggcggcg
gcggccgcaggggccccggtgccggtcagccagccgctgctcaccttcccgcaccctgtc
tactactcgcacccggtggtctcgtctgtgccgctgctacggccggtgtga

DBGET integrated database retrieval system