KEGG   Rattus norvegicus (rat): 29354Help
Entry
29354             CDS       T01003                                 

Gene name
Pla2g5
Definition
(RefSeq) phospholipase A2, group V
  KO
K01047  secretory phospholipase A2 [EC:3.1.1.4]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00564  Glycerophospholipid metabolism
rno00565  Ether lipid metabolism
rno00590  Arachidonic acid metabolism
rno00591  Linoleic acid metabolism
rno00592  alpha-Linolenic acid metabolism
rno01100  Metabolic pathways
rno04014  Ras signaling pathway
rno04270  Vascular smooth muscle contraction
rno04972  Pancreatic secretion
rno04975  Fat digestion and absorption
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    29354 (Pla2g5)
   00565 Ether lipid metabolism
    29354 (Pla2g5)
   00590 Arachidonic acid metabolism
    29354 (Pla2g5)
   00591 Linoleic acid metabolism
    29354 (Pla2g5)
   00592 alpha-Linolenic acid metabolism
    29354 (Pla2g5)
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    29354 (Pla2g5)
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    29354 (Pla2g5)
  09154 Digestive system
   04972 Pancreatic secretion
    29354 (Pla2g5)
   04975 Fat digestion and absorption
    29354 (Pla2g5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rno03036]
    29354 (Pla2g5)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     29354 (Pla2g5)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centriole proteins
    29354 (Pla2g5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Phospholip_A2_1 Phospholip_A2_2
Motif
Other DBs
NCBI-GeneID: 29354
NCBI-ProteinID: NP_058870
RGD: 62051
Ensembl: ENSRNOG00000016838
UniProt: P51433
Position
5q36
AA seq 137 aa AA seqDB search
MKRLLTLAWFLACSVPAVPGGLLELKSMIEKVTGKNAVKNYGFYGCYCGWGGHGTPKDGT
DWCCRMHDRCYGLLEEKHCAIRTQSYDYRFTQDLVICEHDSFCPVRLCACDRKLVYCLRR
NLWSYNRLYQYYPNFLC
NT seq 414 nt NT seq  +upstreamnt  +downstreamnt
atgaagcgcctcctcacgctggcttggttcctggcttgcagtgtgcctgcagtcccaggg
ggcttgctagaactgaagtccatgattgagaaggtgactgggaagaatgccgtaaagaac
tatggcttctacggctgctactgtggctggggcggccacgggacccctaaggatggcact
gattggtgctgtcggatgcacgaccgttgttatgggctactggaggagaaacactgtgcc
atccggacccagtcctatgactacagattcacacaggacttagtcatctgcgaacacgac
tccttctgtccagtgaggctttgtgcttgtgaccggaagctggtctactgcctgaggaga
aacctctggagttacaaccgtctttaccagtattaccccaacttcctctgctaa

DBGET integrated database retrieval system