KEGG   Rattus norvegicus (rat): 29355Help
Entry
29355             CDS       T01003                                 

Gene name
Pkn1, PAK-1, Prkcl1
Definition
(RefSeq) protein kinase N1
  KO
K06071  protein kinase N [EC:2.7.11.13]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04151  PI3K-Akt signaling pathway
rno05132  Salmonella infection
rno05135  Yersinia infection
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    29355 (Pkn1)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    29355 (Pkn1)
   05135 Yersinia infection
    29355 (Pkn1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rno01001]
    29355 (Pkn1)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.13  protein kinase C
     29355 (Pkn1)
Protein kinases [BR:rno01001]
 Serine/threonine kinases: AGC group
  PKN family
   29355 (Pkn1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase HR1 Pkinase_Tyr Pkinase_C Kinase-like PL48 Uds1 Haspin_kinase C2
Motif
Other DBs
NCBI-GeneID: 29355
NCBI-ProteinID: NP_058871
RGD: 69308
Ensembl: ENSRNOG00000004131
UniProt: Q63433
Position
19q11
AA seq 946 aa AA seqDB search
MAGDAVQSEPRSWSLLEQLGLAGADLAAPGVQQQLELERERLKREIRKELKLKEGAENLR
RATTDLGRSLAPVELLLRGSARRLDLLHQQLQELHAHVVLPDPTAGSDAPQSLAEGSPVC
SSTNLSRVAGLEKQLAIELKVKQGAENMIQTYSNGSTKDRKLLLTAQQMLQDSKTKIDII
RMQLRRALQALQAGQLESQAAPDEAHGDPDLGAVELRIEELRHHFRVEHAVAEGAKNVLR
LLSAAKAPDRKAVSEAQEKLTESNQKLGLLRESLERRLGELPADHPKGRLLREELTAASS
AAFSAILPGPFPATHYSTLSKPAPLTGTLEVRVVGCKNLPETIPWSPPPSVGASGTPDSR
TPFLSRPARGLYNRSGSLSGRSSLKGEAENSTEVSTVLKLDNTVVGQTAWKPCGPNAWDQ
SFTLELERARELELAVFWRDQRGLCALKFLKLEDFLDNERHEVQLDMEPQGCLVAEVTFR
NPIIERIPRLQRQKKIFSKQQGQTFQRARQMNIDVATWVRLLRRLIPNAVATGSFSPNAS
PGSEIRSTGDISMEKLNLGADSDSSSQKSPAGLPSTSCSLSSPTHESTTSPELPSETQET
PGPGLCSPLRKSPLTLEDFKFLAVLGRGHFGKVLLSEFHSSGELFAIKALKKGDIVARDE
VESLMCEKRILATVTRAGHPFLVNLFGCFQTPEHVCFVMEYSAGGDLMLHIHSDVFSEPR
AVFYSACVVLGLQFLHEHKIVYRDLKLDNLLLDTEGYVKIADFGLCKEGMGYGDRTSTFC
GTPEFLAPEVLTDTSYTRAVDWWGLGVLLYEMLVGESPFPGDDEEEVFDSIVNDEVRYPR
FLSAEAIGIMRRLLRRNPERRLGSTERDAEDVKKQPFFRTLDWDALLARRLPPPFVPTLS
GRTDVSNFDEEFTGEAPTLSPPRDARPLTAAEQAAFRDFDFVAGGY
NT seq 2841 nt NT seq  +upstreamnt  +downstreamnt
atggccggcgacgccgtgcagagtgaacctcgcagctggtcactgctggagcagctgggt
ctggctggggcagacctggcagcccctggggtgcagcagcagctggagttagagcgagag
cggctgaagcgggaaatccgaaaagagctgaagctgaaggagggcgctgagaacctgagg
cgggccaccactgacctgggccgcagcttggcccctgtggaactgctgctgaggggctcc
gctagacggcttgacttgctgcaccagcagctgcaggagctgcatgcacatgtggtgctg
cccgaccctacagcggggagtgatgctccccaatcccttgcagagggcagccctgtctgc
tcatccaccaacctgagccgagtggctggcctggagaagcagctggccattgagctcaag
gtcaaacagggggcagaaaacatgatccagacctacagcaatggcagcaccaaggaccgg
aagctgctgttgacggcccaacagatgctgcaggatagtaagaccaagattgacatcatc
cgcatgcagcttcgccgggcgctacaagcactccaggctggccagctggagagtcaggca
gctcctgatgaggcccacggagatccagacctgggagccgtagagctacgcattgaggag
ctacgacaccattttcgagtagagcatgcagtggcagaaggcgccaagaatgtcctgcgt
ctgctcagtgctgcaaaggccccagaccgcaaagcagtcagcgaggctcaggagaaattg
actgagtccaaccagaagctgggcttgctgcgggagtcactggagaggcgcttgggggaa
ctgcctgctgatcaccccaagggacgcctgcttcgggaggagctcactgcggcctcatcg
gcagccttcagtgcaatactgcctgggcccttccctgccactcactacagcaccttgagc
aagcctgcaccactcacagggaccctggaagtacgagtggtgggctgcaaaaaccttccc
gagaccatcccttggagccctcccccctcagtcggggcatctgggacccccgacagccgc
actcctttcctgagtcgtccagctcggggcctttacaaccgaagtggaagccttagtgga
cggagcagcctcaagggggaggcagagaattccactgaggtcagcaccgtgctcaagctg
gacaacactgtggtggggcaaacagcctggaagccatgcggccccaatgcctgggaccag
agcttcaccctggagctggagagggctcgggagctggagttggctgtgttctggcgtgac
cagaggggtctgtgtgctctcaaatttctgaagttggaagacttcttggacaatgagagg
catgaggtgcagctggacatggaaccccagggctgcctggtggctgaggtcaccttccgt
aaccccatcatcgagcggatccctaggctccaaaggcagaaaaaaattttctccaagcag
caagggcagacatttcagcgtgccagacagatgaacatcgatgtggccacctgggtgcgg
ctgctccggagactcatcccgaacgccgtggccactggctccttcagccccaatgcatct
ccaggctctgagatccggagcactggagacatatccatggagaaattgaatctcggtgct
gactcagacagctcgtcccagaagagccccgcagggctgccctccacctcatgtagcctg
agttctccaacccacgaatccaccacctctccagagctgccttcagagacccaggagacc
ccaggccctggcctgtgcagtcccctgaggaagtcgcccctgacgcttgaggacttcaag
ttcctggcagtgcttggtcggggtcactttggaaaggtgctgctgtctgaattccactcc
agtggggagctctttgccattaaagccttgaagaaaggtgacattgtagcccgggatgag
gttgagagcctgatgtgtgagaagcggattttggcgaccgtgaccagggcaggacatccc
ttcctggtgaaccttttcggctgtttccagaccccagagcatgtgtgctttgtgatggag
tactcagccggtggggacttgatgctgcatatccacagcgacgtgttctcagagcctcgg
gctgtcttctattcggcctgtgtggtgctgggactgcagttcctccatgaacacaagatt
gtctacagggacctgaagttggacaatttgctcctggatactgagggctacgtcaagatc
gcagactttggcctctgcaaggaggggatgggctatggggaccggaccagcacattctgc
ggaactccggagttcctggcgccggaagtgctcacagacacatcctacactcgagccgtg
gactggtggggactgggtgtattgctctatgagatgctggttggagagtctccgttccct
ggggacgacgaggaggaagtatttgacagcatcgtcaatgatgaggttcgttatccccgc
ttcctgtctgcggaggccatcggcatcatgagaaggctactgcggaggaacccagagcgg
aggttgggatccactgagcgtgatgcagaagatgtgaaaaaacagcctttcttcaggact
ctggactgggatgccctgctggcccgtcgcctgcctccacccttcgtgcctacactttcg
gggcgcacagacgtcagcaacttcgatgaggagttcactggggaggcccccacactgagc
cctccccgggatgcacggcccctgacagctgcggagcaggcggccttccgggatttcgac
tttgtggcaggaggctattag

DBGET integrated database retrieval system