KEGG   Rattus norvegicus (rat): 293561
Entry
293561            CDS       T01003                                 

Gene name
Rnf152
Definition
(RefSeq) ring finger protein 152
  KO
K15705  E3 ubiquitin-protein ligase RNF152 [EC:2.3.2.27]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04150  mTOR signaling pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04150 mTOR signaling pathway
    293561 (Rnf152)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:rno04121]
    293561 (Rnf152)
Enzymes [BR:rno01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     293561 (Rnf152)
Ubiquitin system [BR:rno04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    293561 (Rnf152)
SSDB
Motif
Pfam: zf-RING_5 zf-C3HC4 zf-RING_2 zf-RING_UBOX zf-RING_11 zf-C3HC4_2 zf-C3HC4_4 VMA21 Prok-RING_4 zf-RING_10
Other DBs
NCBI-GeneID: 293561
NCBI-ProteinID: NP_001099775
RGD: 1305251
Ensembl: ENSRNOG00000014859
UniProt: D4A723
Position
13p11
AA seq 203 aa
METLSQDSLLECQICFNYYSPRRRPKLLDCKHTCCSVCLQQMRTSQKDVRCPWCRGITKL
PPGFSVSQLPDDPEVLAVIAIPHTSEHTPVFIKLPSNGCYMLPLPISKERTLLPGDMGCR
LLPGSQQKSLTVVTIPAEQQPLQGGAPQEAVEEEPDRRGVAKSSTWSGVCTVILVACVLV
FLLGIVLHNMSCISKRFTVISCG
NT seq 612 nt   +upstreamnt  +downstreamnt
atggagacgctctcccaggattccctgctggaatgtcagatatgttttaattattacagc
ccccgacgaaggcccaagttgctggattgcaagcacacctgctgctcagtgtgcctccag
cagatgaggaccagccagaaggacgtaaggtgtccctggtgccgtggcatcaccaagttg
cccccgggcttctctgtatcacagctgcccgatgatcctgaggtcttggcggtcatcgcc
ataccacacacttccgagcacaccccagtcttcatcaaacttccaagcaatgggtgctac
atgctgcccctgcccatctctaaagagcgtacactcctgccgggagacatgggctgccgc
ctgctgccagggagccagcagaagtctctcactgtggtgaccatccctgcagagcagcag
cccctgcagggtggagctccccaggaggccgtggaggaggagcctgacagacggggcgtg
gcgaagagttccacgtggtctggcgtgtgcactgtcatcctggtggcctgtgtgttggtc
ttccttctgggcattgtgctacacaacatgtcctgcatctctaagcgtttcactgttata
tcctgtggttga

DBGET integrated database retrieval system