KEGG   Rattus norvegicus (rat): 29357
Entry
29357             CDS       T01003                                 

Gene name
Smad2
Definition
(RefSeq) mothers against decapentaplegic homolog 2
  KO
K04500  mothers against decapentaplegic homolog 2
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04110  Cell cycle
rno04144  Endocytosis
rno04218  Cellular senescence
rno04350  TGF-beta signaling pathway
rno04371  Apelin signaling pathway
rno04390  Hippo signaling pathway
rno04550  Signaling pathways regulating pluripotency of stem cells
rno04659  Th17 cell differentiation
rno04926  Relaxin signaling pathway
rno04933  AGE-RAGE signaling pathway in diabetic complications
rno05142  Chagas disease
rno05166  Human T-cell leukemia virus 1 infection
rno05200  Pathways in cancer
rno05205  Proteoglycans in cancer
rno05210  Colorectal cancer
rno05212  Pancreatic cancer
rno05225  Hepatocellular carcinoma
rno05226  Gastric cancer
rno05321  Inflammatory bowel disease
rno05415  Diabetic cardiomyopathy
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    29357 (Smad2)
   04390 Hippo signaling pathway
    29357 (Smad2)
   04371 Apelin signaling pathway
    29357 (Smad2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    29357 (Smad2)
  09143 Cell growth and death
   04110 Cell cycle
    29357 (Smad2)
   04218 Cellular senescence
    29357 (Smad2)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    29357 (Smad2)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    29357 (Smad2)
  09152 Endocrine system
   04926 Relaxin signaling pathway
    29357 (Smad2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    29357 (Smad2)
   05205 Proteoglycans in cancer
    29357 (Smad2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    29357 (Smad2)
   05212 Pancreatic cancer
    29357 (Smad2)
   05225 Hepatocellular carcinoma
    29357 (Smad2)
   05226 Gastric cancer
    29357 (Smad2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    29357 (Smad2)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    29357 (Smad2)
  09163 Immune disease
   05321 Inflammatory bowel disease
    29357 (Smad2)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    29357 (Smad2)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    29357 (Smad2)
SSDB
Motif
Pfam: MH2 MH1 IRF-3
Other DBs
NCBI-GeneID: 29357
NCBI-ProteinID: NP_001264379
RGD: 3031
Ensembl: ENSRNOG00000018140
UniProt: O70436
Position
18
AA seq 467 aa
MSSILPFTPPVVKRLLGWKKSAGGSGGAGGGEQNGQEEKWCEKAVKSLVKKLKKTGRLDE
LEKAITTQNCNTKCVTIPSTCSEIWGLSTANTVDQWDTTGLYSFSEQTRSLDGRLQVSHR
KGLPHVIYCRLWRWPDLHSHHELKAIENCEYAFSLKKDEVCVNPYHYQRVETPVLPPVLV
PRHTEILTELPPLDDYTHSIPENTNFPAGIEPQSNYIPETPPPGYISEDGETSDQQLNQS
MDTGSPAELSPTTLSPVNHSLDLQPVTYSEPAFWCSIAYYELNQRVGETFHASQPSLTVD
GFTDPSNSERFCLGLLSNVNRNATVEMTRRHIGRGVRLYYIGGEVFAECLSDSAIFVQSP
NCNQRYGWHPATVCKIPPGCNLKIFNNQEFAALLAQSVNQGFEAVYQLTRMCTIRMSFVK
GWGAEYRRQTVTSTPCWIELHLNGPLQWLDKVLTQMGSPSVRCSSMS
NT seq 1404 nt   +upstreamnt  +downstreamnt
atgtcgtccatcttgccattcactccgccagtggtgaagagacttctgggatggaaaaaa
tcagccggtgggtctggaggagcaggtggtggagaacagaatggacaggaagaaaagtgg
tgtgaaaaagcagtgaaaagtctggtgaaaaagctaaagaaaacaggacgattagatgag
cttgagaaagccatcaccactcagaattgcaatactaagtgtgtcaccataccaagcact
tgctctgaaatttggggactgagtacagcaaatacggtagatcagtgggacacaacaggc
ctttacagcttctctgaacaaaccaggtctcttgatggtcgtcttcaggtgtctcatcgg
aaagggctgccacatgttatatattgccggctgtggcgctggccagaccttcacagccat
catgagctcaaggcgatcgagaactgcgaatacgctttcagtctgaaaaaagatgaagtg
tgtgtgaacccttaccactaccagagggtggagacaccagtcttgcctccagtcttggtg
cctcggcacacagagattctaacagaactgccgcctctggatgactatacccactccatt
ccagaaaacacaaatttcccagcaggaattgagccacagagtaattacatcccagaaaca
ccaccacctggatatatcagtgaagatggagaaactagtgaccaacagttgaaccaaagt
atggacacaggctctccggctgaactgtctcctaccactctctcccctgtcaatcacagc
ttggatttgcagccagttacttattcagaacctgcattttggtgttcaatcgcatattat
gaactaaaccagagggttggagagaccttccatgcgtcacagccctcactcactgtagac
ggctttacagatccatcgaactcggagaggttctgcttaggtttgctctccaacgttaac
agaaacgctactgtagaaatgaccagaaggcatataggaaggggagtgcgcttgtattac
ataggtggggaagtgtttgccgagtgcctaagtgatagtgcgatctttgtgcagagcccc
aactgtaaccagagatacggctggcaccccgcgacagtgtgcaaaatcccaccaggctgt
aacctgaagatcttcaacaaccaagaatttgctgctcttctggctcagtctgttaaccag
ggttttgaggccgtttatcagctgactcgaatgtgcaccataagaatgagcttcgtgaag
gggtggggagcagaataccggaggcagacagtaacaagtactccttgctggattgaactt
catctgaatggccccctgcagtggttggacaaagtattaactcagatgggatccccgtca
gtgcgatgctcaagcatgtcctaa

DBGET integrated database retrieval system