KEGG   Rattus norvegicus (rat): 29359
Entry
29359             CDS       T01003                                 

Gene name
Pla2g10, PLA2GX, sPLA2-X
Definition
(RefSeq) phospholipase A2, group X
  KO
K01047  secretory phospholipase A2 [EC:3.1.1.4]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00564  Glycerophospholipid metabolism
rno00565  Ether lipid metabolism
rno00590  Arachidonic acid metabolism
rno00591  Linoleic acid metabolism
rno00592  alpha-Linolenic acid metabolism
rno01100  Metabolic pathways
rno04014  Ras signaling pathway
rno04270  Vascular smooth muscle contraction
rno04972  Pancreatic secretion
rno04975  Fat digestion and absorption
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    29359 (Pla2g10)
   00565 Ether lipid metabolism
    29359 (Pla2g10)
   00590 Arachidonic acid metabolism
    29359 (Pla2g10)
   00591 Linoleic acid metabolism
    29359 (Pla2g10)
   00592 alpha-Linolenic acid metabolism
    29359 (Pla2g10)
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    29359 (Pla2g10)
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    29359 (Pla2g10)
  09154 Digestive system
   04972 Pancreatic secretion
    29359 (Pla2g10)
   04975 Fat digestion and absorption
    29359 (Pla2g10)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rno03036]
    29359 (Pla2g10)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     29359 (Pla2g10)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centriole proteins
    29359 (Pla2g10)
SSDB
Motif
Pfam: Phospholip_A2_1 Parvo_coat_N
Other DBs
NCBI-GeneID: 29359
NCBI-ProteinID: NP_058872
RGD: 61935
Ensembl: ENSRNOG00000003164
UniProt: Q9QZT3
Position
10q11
AA seq 151 aa
MLLLLLLLLLGPGSCLSEATRRSHVYKRGLLELAGTLDCVGPRSPMAYMNYGCYCGLGGH
GEPRDAIDWCCYYHDCCYSQAQDAGCSPKLYRYPWKCMDHRILCGPAENKCQELLCRCDE
TLAYCLADTEYHLKYLFFPSVLCEKDSPKCN
NT seq 456 nt   +upstreamnt  +downstreamnt
atgctgctgctactgctgctgttgctactgggacctggatcctgtctcagcgaagcaacc
aggaggtcacatgtgtacaagcgtggactcctggaactggcagggaccttggattgtgtt
ggtcctcgatcgccgatggcttacatgaactatggttgttattgtggccttggtggccac
ggagagccacgtgatgccattgactggtgctgctactaccatgactgctgctactctcag
gctcaggatgccggctgcagccccaagctataccgatacccgtggaagtgcatggaccat
cgcatcctgtgtggaccggcagagaacaaatgccaagaactcctatgcaggtgtgatgag
acgctcgcatactgcctggcagacacagagtaccacctgaaatacctcttcttcccctcg
gttttatgtgagaaggactcacccaagtgcaactaa

DBGET integrated database retrieval system