KEGG   Rattus norvegicus (rat): 293591Help
Entry
293591            CDS       T01003                                 

Gene name
Cd163l1, RGD1307378
Definition
(RefSeq) CD163 molecule-like 1
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif
Pfam: SRCR SRCR_2
Motif
Other DBs
NCBI-GeneID: 293591
NCBI-ProteinID: NP_001099782
RGD: 1307378
Ensembl: ENSRNOG00000018978
UniProt: D4AEN2
Position
1q41
AA seq 995 aa AA seqDB search
MRTTLWTLSLGSLLTLRAALIGTSSEDGQGNLRLAHRQSKCDGVVLVRHQGEWGHLCNLE
WTLAEASVVCRQLGCGPAVGAPKYVPLPGEMVQPWLHNVSCWGNESSLWECSLGAWSQRA
CPHEWVVVALCANGTFREIRLVKGHSPCAGLPEIRNVNGVDRLCGLHVEEATVFCRELEC
GHALQAPRQDVGVSKYMTCKGTEPTIRNCRLNNKLRGGCNLLLDAEVVCSGHVEARLVGG
DHSCSGRLEVLRGLTWGTVCHADLDLPTAHVICRELGCGMAVSTLRGAQFGQGSGPVWLE
AFRCVGNESMLFHCPQEPGHHCGHNQDVALTCSEFRLVNGSSDCEGRVELQVQGAWAPLC
AANWDLADAMVLCHQLNCGNAVSIPPGGHFGDGDAPIWPDVFHCVGTEPHLLHCPASTLG
AHSCVLGNTASTICSGLQDTLRLRDGQSYCDGRVEISLNGSWGRVLDDIWDIRGASVVCR
QLECGEAQGAYDAPAPGFRTAPVGLSQVRCLGSETHLMQCNVSTSLLVPAATLRDAGVVC
SGSLRMRLAAGPGRCAGRVEVFYQGSWGTVCDDAWDLQDAQVVCRQLDCGHALSAPGNAH
FGAGTGRIWMDELHCLGNESLLWKCQSGNWGQHDCRHKEDAGVFCSESVALRLRGGTSGC
VGWLDVLYNGSWGAVCSNALRDISLSIMCRQLGCGDQGWLENRPSPGPGLGISWVDKIKC
RKLHNATLWQCPSAPWNPHSCTQEEEVWINCEGLPQIGSQEPAQTPNCSSPLGCLEDSVL
RVLGGEDGCSGRVELWHAGSWGTVCDDSWDLLDAQVVCRQLGCGQALAALEGAAFGPGMG
PVWLDEVECLGSEVTLEACQAELWGHGDCTHKEDAGVRCAGVSTTTALSPSLTPPPVAEA
WNLPEVACLVLGCLLGIVFLAMIAQWCHIRDASMGSGMLGNLQSDGVYEDIEVVPVMKKE
ENAISRLLMLEDGYDDAEEPEGQPTESEEECNGHC
NT seq 2988 nt NT seq  +upstreamnt  +downstreamnt
atgaggacaacactctggactctgagtttggggtctcttcttactctcagggcagctctc
attggcacatcttctgaagatggccaaggcaatctgaggctggcacacaggcagagcaag
tgcgacggagtggtgctggttcgacaccaaggggaatggggccatctgtgcaacctggag
tggacactggcagaagcctctgtggtgtgtagacagctgggctgtggccctgccgttggc
gctcccaaatacgtgcccctgcctggagagatggtccagccctggctgcacaatgtatcc
tgttggggcaatgagtcctctctctgggagtgtagccttggggcatggagtcagcgtgct
tgcccccatgagtgggtggtggtggctctctgtgcaaatggcaccttccgggagatccgg
ctagtgaagggccacagtccctgtgcaggactccccgagatcaggaatgtgaatggggtg
gaccgcctctgtggcctgcatgtggaagaggccacggtgttctgccgtgagctggagtgt
ggccatgcactccaggccccccgtcaagacgtgggtgtcagtaagtacatgacctgcaag
ggcactgagcccaccatccgtaactgcagacttaacaacaagctacgtggaggctgcaac
ctgctgctggatgcagaagtggtctgctcaggacacgtggaggcccggctggtgggtgga
gaccattcttgttctggacgcctggaggttcttcggggactgacctggggtaccgtctgc
catgctgatctggacttgcccacagcccatgtgatctgtcgggagttagggtgtggtatg
gctgtgtccacacttaggggtgcccagtttggccagggctcggggcctgtgtggctagaa
gccttccgctgtgtggggaatgaatcgatgctgttccactgccctcaggagcctgggcac
cactgcggccacaaccaggatgttgcactcacctgctcagagttccggctagtcaatggt
agcagtgactgtgaaggccgagtggaactccaagtgcaaggggcctgggcacccctctgt
gctgccaactgggacctagcagacgccatggttctctgtcaccaactcaactgtggcaat
gcagtatccatacccccaggaggacattttggtgacggggatgcccccatctggccagat
gtatttcattgtgtggggacagagccccatttgcttcactgtccagcaagcaccctgggg
gcccacagttgtgtcctgggaaatacagcttccaccatctgttcaggactccaagacacc
ctgcggctgagagatggacagagctactgtgatggccgcgtagagatttccctgaatggt
tcatggggccgcgtattggatgacatctgggacatacgtggtgccagtgtggtgtgcagg
cagctagagtgtggagaggcacagggagcttatgatgctccagctcctggcttcaggaca
gcccctgtggggctgagccaggtgcgctgcctgggctctgagactcacctgatgcagtgc
aatgtttctacctccctgctggtgcctgctgcgaccttgcgtgatgcaggagtggtatgc
tccgggagcctgcgcatgaggctggctgcgggcccaggtcgatgtgctgggcgtgtggaa
gtattctatcagggctcatggggcactgtgtgcgatgatgcgtgggaccttcaggacgca
caagtggtctgtaggcaactggactgtggccacgccctcagtgctcccgggaatgctcac
tttggggcagggactgggcgcatctggatggatgagctgcactgcttgggaaatgagtct
ttgttgtggaagtgccagtcaggaaactggggccaacatgactgcagacacaaagaagat
gctggagtgttctgctcagaatctgtggctctgaggctgcgaggtggcaccagtggctgc
gttggatggctggacgtgctctacaatggatcctggggtgctgtgtgcagcaatgcactc
agagacatctccttgagcatcatgtgcagacagctgggatgtggggaccagggctggctg
gagaacaggccgtctcctgggcctggcttgggaatctcctgggtggataagatcaagtgt
cgaaagctacacaatgccactctgtggcagtgcccttctgccccatggaacccacactcc
tgtacccaggaggaggaggtctggattaactgtgaaggactgccacagataggttcacag
gagcccgcacagacccctaactgctcttccccacttggctgcttagaggacagcgtattg
cgtgtgctcggaggcgaggatggctgttccgggcgtgtggagctctggcacgcaggctcg
tggggcacagtgtgtgatgactcctgggacctgctggatgcccaggttgtgtgccggcag
ctgggctgtggccaggccttagctgctttggaaggtgccgcctttggccctggtatgggg
cctgtgtggttggatgaggtggagtgccttggcagcgaggtgaccttggaggcctgccag
gctgagctctggggacacggagactgcacgcacaaggaggatgcaggtgttcgttgtgca
ggtgtctccacaaccactgcattgtctccttccctgacgcctccacccgttgctgaggcc
tggaacctgcctgaggttgcctgcttggtgcttggctgcctcctgggcattgtcttcctg
gctatgattgcccagtggtgtcacatcagagatgctagcatgggttctggcatgttgggg
aatctacagtcagatggtgtctatgaggacattgaagttgtccctgtgatgaagaaagag
gagaacgcaatatccaggctgctgatgctggaagacggttatgatgatgctgaagagccc
gagggtcagcctacagagagtgaggaggagtgcaatgggcactgctga

DBGET integrated database retrieval system