KEGG   Rattus norvegicus (rat): 29360Help
Entry
29360             CDS       T01003                                 

Gene name
Selenop, Sepp1
Definition
(RefSeq) selenoprotein P
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif
Pfam: SelP_N SelP_C Rap1-DNA-bind
Motif
Other DBs
NCBI-GeneID: 29360
NCBI-ProteinID: NP_001077380
RGD: 3660
UniProt: P25236
Position
2q16
AA seq 385 aa AA seqDB search
MWRSLGLALALCLLPYGGAESQGQSPACKQAPPWNIGDQNPMLNSEGTVTVVALLQASUY
LCLLQASRLEDLRIKLENQGYFNISYIVVNHQGSPSQLKHAHLKKQVSDHIAVYRQDEHQ
TDVWTLLNGNKDDFLIYDRCGRLVYHLGLPYSFLTFPYVEEAIKIAYCEKRCGNCSFTSL
EDEAFCKNVSSATASKTTEPSEEHNHHKHHDKHGHEHLGSSKPSENQQPGALDVETSLPP
SGLHHHHHHHKHKGQHRQGHLESUDMGASEGLQLSLAQRKLURRGCINQLLCKLSEESGA
ATSSCCCHCRHLIFEKSGSAITUQCAENLPSLCSUQGLFAEEKVIESCQCRSPPAAUHSQ
HVSPTEASPNUSUNNKTKKUKUNLN
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atgtggagaagcctagggcttgccctggctctctgtctcctcccctatggaggagcagag
agccaaggccaaagccctgcttgtaagcaagctccaccctggaacataggagatcaaaat
ccaatgctaaactccgagggcacagtgacagtggttgctcttcttcaagccagctgatac
ctgtgccttctgcaggcatccagattggaagacctgcgaataaaactagagaaccaagga
tattttaacatctcctatattgttgttaatcatcaaggatctccttcccaattaaaacat
gcacatcttaaaaagcaggtgtcagatcacattgctgtttacagacaagatgaacatcaa
acagatgtctggacactcttaaatggaaacaaagatgacttcctcatatatgacagatgt
ggccgtcttgtgtatcaccttggtttgccctactccttcctcactttcccgtatgttgaa
gaagccatcaagatcgcttactgtgagaagaggtgtggaaactgctctttcacgagtctt
gaagatgaagccttctgtaaaaacgtgtcctcggctactgcaagtaaaaccacagagccc
tcagaggagcataaccaccacaagcaccatgacaaacatgggcatgagcatcttgggagc
agtaagccttcagagaatcagcaaccaggggcattagatgttgagacaagtcttcctcct
tcaggcttgcaccaccaccaccaccaccataagcacaagggccagcacaggcagggtcac
ttagagagctgagacatgggggcaagtgaaggcttgcaactttcacttgcccagaggaag
ctctgacgaaggggatgcataaaccagctcctgtgtaagttatctgaggagtctggggca
gctaccagtagctgctgctgccactgccgacacctcatatttgagaagtcaggatctgca
atcacttgacagtgtgccgaaaacctcccatccttgtgtagctgacaggggcttttcgcg
gaggagaaagtcattgaatcctgtcaatgtagatcacctccagctgcctgacacagtcag
catgtaagccccacagaagccagccccaactgaagctgaaataataagaccaagaagtga
aaatgaaatttgaactaa

DBGET integrated database retrieval system