KEGG   Rattus norvegicus (rat): 293620Help
Entry
293620            CDS       T01003                                 

Gene name
Ptdss2, PSS-2
Definition
(RefSeq) phosphatidylserine synthase 2
  KO
K08730  phosphatidylserine synthase 2 [EC:2.7.8.29]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00564  Glycerophospholipid metabolism
rno01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    293620 (Ptdss2)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.8  Transferases for other substituted phosphate groups
    2.7.8.29  L-serine-phosphatidylethanolamine phosphatidyltransferase
     293620 (Ptdss2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PSS
Motif
Other DBs
NCBI-GeneID: 293620
NCBI-ProteinID: NP_001099786
RGD: 1307914
Ensembl: ENSRNOG00000015912
UniProt: B2GV22
Position
1q41
AA seq 471 aa AA seqDB search
MRRGERRVAGGSGSESPLLEGRRSTESEVYDDGTNTFFWRAHTLTVLFILTCALGYVTLL
EETPQDTAYNTKRGIVASILVFLCFGVTQAKDGPFSRPHPAYWRFWLCVSVVYELFLIFI
LFQTVHDGRQFLKYVDPRLGVPLPERDYGGNCLIYDADNKTDPFHNIWDKLDGFVPAHFI
GWYLKTLMIRDWWMCMIISVMFEFLEYSLEHQLPNFSECWWDHWIMDVLLCNGLGIYCGM
KTLEWLSLKTYKWQGLWNIPTYKGKMKRIAFQFTPYSWVRFEWKPASSLHRWLAVCGIIL
VFLLAELNTFYLKFVLWMPPEHYLVLLRLVFFVNVGGVAMREIYDFMDELKPHRKLGQQA
WLVAAITVTELLIVVKYDPHTLTLSLPFYISQCWTLGSILVLTWTVWRFFLRDITMRYKE
TRRQKQQSHQAINNGDGHPGPEDDLPGTGTAEEEGTTNDGVPAEEGPSAAS
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
atgcggaggggagagcgcagagtcgccggaggctcgggatctgagtctccgctgctcgag
ggccgccgcagcaccgagtccgaggtctacgatgatggcactaacaccttcttttggcgc
gcccacaccttaactgtgctgttcatcctcacctgcgcactcggctatgtgaccctccta
gaagaaacccctcaggatacagcctacaacactaagagaggtattgtggccagtattttg
gttttcttatgttttggagtcacacaagccaaagacgggccattttccagacctcatcca
gcttactggcggttttggctgtgtgttagtgtggtctacgagttgtttctcatcttcatc
cttttccagacagtccatgatggccggcagtttctgaagtatgtggatcccaggctggga
gtcccattgccagagagggactacggtggcaactgcctcatctatgatgctgacaacaag
actgaccccttccacaacatctgggacaagctggatggctttgttcctgcacacttcatt
ggctggtatctgaagaccctcatgatccgtgactggtggatgtgtatgatcatcagtgtg
atgttcgagttcctggagtacagcctggagcaccagctacccaacttcagcgagtgctgg
tgggaccattggatcatggacgtactcctctgcaacgggctgggcatctactgtggcatg
aagaccctcgagtggctgtccttgaagacatataagtggcagggcctctggaacattcca
acctacaagggcaagatgaagaggattgcctttcagttcacaccttatagctgggtacgc
tttgagtggaagccagcctccagcctgcaccgctggctggccgtgtgtggcatcatcctg
gtgttcctgctggcagagctgaacacattctacctgaagtttgtgctttggatgccccct
gaacactatctggtccttctgcgtctggtcttcttcgtgaacgtgggtggtgtggccatg
cgtgagatctatgacttcatggatgaattgaagccccacaggaagctgggccagcaggcc
tggctggtggcagccatcacagtcacagagctgctcatcgtggtgaagtatgacccgcac
acactcaccctgtcactgcccttctacatctcccagtgctggactctgggctccatcctg
gtgcttacatggactgtctggcgcttcttcctgcgggacatcaccatgaggtacaaggag
acccggcgacagaagcagcagagtcaccaggccatcaacaacggggatgggcacccaggg
ccggaggatgacctgccagggactggaactgcagaggaagaggggaccaccaatgatggt
gtacctgctgaggaggggccctcagctgcttcatga

DBGET integrated database retrieval system