KEGG   Rattus norvegicus (rat): 293631
Entry
293631            CDS       T01003                                 

Gene name
Brsk2
Definition
(RefSeq) BR serine/threonine kinase 2
  KO
K08796  BR serine/threonine kinase [EC:2.7.11.1]
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rno01001]
    293631 (Brsk2)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    293631 (Brsk2)
   03036 Chromosome and associated proteins [BR:rno03036]
    293631 (Brsk2)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     293631 (Brsk2)
Protein kinases [BR:rno01001]
 Serine/threonine kinases: CAMK group
  CAMKL family
   293631 (Brsk2)
Membrane trafficking [BR:rno04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    293631 (Brsk2)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Other centrosome duplication proteins
     293631 (Brsk2)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr APH Kinase-like Choline_kinase Kdo
Other DBs
NCBI-GeneID: 293631
NCBI-ProteinID: XP_017445745
RGD: 1566256
Position
1q41
AA seq 681 aa
MFLVPHMLRRTVRWASAWNTFADAHHASFYLPALLLYHPWQEPGFCALGFPGGLVKLGIH
CVTCQKVAIKIVNREKLSESVLMKVEREIAILKLIEHPHVLKLHDVYENKKYLYLVLEHV
SGGELFDYLVKKGRLTPKEARKFFRQIISALDFCHSHSICHRDLKPENLLLDERNNIRIA
DFGMASLQVGDSLLETSCGSPHYACPEVIRGEKYDGRKADVWSCGVILFALLVGALPFDD
DNLRQLLEKVKRGVFHMPHFIPPDCQSLLRGMIEVDAARRLTLEHIQKHIWYIGGKNEPE
PEQPIPRKVQIRSLPSLEDIDPDVLDSMHSLGCFRDRNKLLQDLLSEEENQEKMIYFLLL
DRKERYPSHEDEDLPPRNEIDPPRKRVDSPMLNRHGKRRPERKSMEVLSVTDGGSPVPAR
RAIEMAQHGQSKAVFSKSLDIAEAHPQFSKEDRSRSISGASSGLSTSPLSSPRPVRKFVL
PPLPPELPYVACPLATSLEPEACRSTSRPGHILSPQAALRPNPKTQTLPCKAKLTDKPLQ
GTKSNPLPACTQTQPPGASLGTPLALSPGPPTLPAPARLLPTGTEPNTKSVPTIQVTPHP
SPRGSPLPTPKGTPVHTPKESPAGTPNPTPPSSPSVGGVPWRTRLNSIKNSFLGSPRFHR
RKLQVPTPEEMSNLTPESSPE
NT seq 2046 nt   +upstreamnt  +downstreamnt
atgttccttgttcctcacatgctgagacgtacagtcagatgggcctctgcctggaacaca
tttgcggatgctcaccatgcctccttctacctgccagccctgctcctataccatccttgg
caagaacctggattttgcgctctgggatttcctgggggcttggtgaaactgggaatccac
tgtgtcacctgccagaaggtcgccatcaaaatcgtcaaccgtgagaagctcagtgagtcg
gtgctgatgaaggtggagcgagagattgccatcttgaagctcatcgaacatccacatgta
ctgaagctgcatgacgtctatgaaaacaaaaaatatttatacctggtgctagaacatgtg
tctgggggagagctgttcgactacctggtgaagaagggccggctgacccccaaggaggcc
cgcaagttcttccggcagatcatctctgcactggacttctgccacagccactccatatgc
catagagacttgaagccagagaacctgctgctggatgagaggaacaacatccgtattgca
gactttggcatggcgtccctgcaggtgggagacagcctgctggagaccagctgcggatct
ccacactatgcctgtccggaagtgattcggggcgagaagtatgatggccgcaaggcagat
gtgtggagctgtggtgtgatcctgttcgccttgctggtgggggctctgccgtttgatgat
gacaacctgcggcagttgctggagaaggtcaagcgtggtgtgttccacatgccacacttc
atcccaccagactgccagagcctcctgcgtggcatgattgaggtggatgcagctcggcgc
ctcacgctagagcacattcagaaacacatatggtatataggtggcaagaatgagccagag
ccggaacagcccatcccacgcaaggtgcagatccgctcactgcccagcctggaagacatt
gaccctgatgtactggacagcatgcattcactgggctgcttccgagaccgcaacaagctg
ctgcaggacctgctatctgaggaggagaatcaggaaaagatgatttatttcctcctcctg
gaccggaaagaacggtaccccagccatgaggatgaggacctgccccccaggaatgagata
gaccctcctcggaagcgcgtggactccccgatgctgaaccggcatggcaagaggcgacct
gagcgcaagtccatggaggtgctcagtgtgacagatggcggctccccagtgcctgcacgg
agagccattgagatggcccagcatggccagagtaaagcagtgttcagtaaaagcctggat
atcgctgaagcccatccccaattcagcaaagaagacagatctcgatccatcagtggtgcc
tcctcaggcctttctacaagtccactcagcagtcctcggcctgttaggaagtttgtcctg
ccccctctgccccctgagctcccctatgtggcttgccccctggccacctccttggagcct
gaagcttgtcggagcacctctcggccaggacacatcctctctccacaggccgccctgcgg
cccaaccccaagactcagaccttgccgtgcaaggccaagctgactgacaagccgctgcag
ggcaccaagtccaacccgctcccagcctgcactcagacccagcctcctggagccagcctt
ggcactccactggccctgtcccctgggccacccaccctgccggctcctgcccggctcctg
ccaactgggactgaaccaaacaccaaatctgtccccaccatacaggtgacccctcacccc
tcaccaaggggtagtccccttcctacccccaaagggacgcctgttcacacgccaaaggag
agcccagctggcacacccaaccccacaccaccgtccagccctagtgttggaggagtgccc
tggcggacacgactcaactccatcaagaacagcttcctgggctcacctcgcttccaccgc
cggaaactgcaagttcccacgccagaggagatgtccaacctgaccccagaatcttctcca
gagtaa

DBGET integrated database retrieval system