KEGG   Rattus norvegicus (rat): 293645Help
Entry
293645            CDS       T01003                                 

Gene name
Ppfia1
Definition
(RefSeq) PTPRF interacting protein alpha 1
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif
Pfam: SAM_1 SAM_2
Motif
Other DBs
NCBI-GeneID: 293645
NCBI-ProteinID: NP_001099790
RGD: 1309009
Ensembl: ENSRNOG00000020857
Vega: OTTRNOG00000002444
UniProt: D3ZZ81
Position
1q42
AA seq 1190 aa AA seqDB search
MMCEVMPTISEAEGPPGGGGSHGSGSPSQPDADSHFEQLMVSMLEERDRLLDTLRETQET
LALTQGKLHEVGHERDSLQRQLNTALPQEFAALTKELNVCREQLLEREEEIAELKAERNN
TRLLLEHLECLVSRHERSLRMTVVKRQAQSPAGVSSEVEVLKALKSLFEHHKALDEKVRE
RLRVALERCSLLEEELGATHKELMILKEQNSQKKALTEGMLDGNHEQENAPSTNGKRSSD
GSLSHEDLAKVLELQEVIDRQAREQSQMKERLASLSSHAAELEEDLDTARKDLIKSEEMN
TKLQREVREAMAQKEDMEERITTLEKRYLAAQREATSVHDLNDKLENEIANKDSMHRQTE
DKNRQLQERLELAEQKLQQTLRKAETLPEVEAELAQRVAALSKAEERHGNIEERLRQMEA
QLEEKNQELQRARQREKMNEEHNKRLSDTVDKLLSESNERLQLHLKERMAALEDKNSLLR
EVENAKKQLEETQHDKDQLVLNIEALKAELEQMRLRGSSLHHGRPHLGSVPDFRFSVADG
HVDAYSTSAVLRRPQKGRLAALRDEPSKVQTLNEQDWERAQQASVLANVAQAFESDVDVS
DGEDDRDTLLSSVDLLSPSGQADAQTLAMMLQEQLDAINKEIRLIQEEKENTEQRAEEIE
SRVGSGSLDNLGRFRSMSSIPPYPASSLAGSSPPGSGRSTPRRVPHSPAREVDRLGVMTL
LPASREEVRDDKTTIKCETSPPSSPRPLRLDRLHKGALHTVSHEDIRDLRNSTGSQDGPV
SNPSSSNSSQDSLHKAPKKKGIKSSIGRLFGKKEKGRPGPLGKESPGQAGVSETENSSQD
ALGLSKLGGQAEKNRKLQKKHELLEEARRQGLPFAQWDGPTVVVWLELWVGMPAWYVAAC
RANVKSGAIMSALSDTEIQREIGISNPLHRLKLRLAIQEIMSLTSPSAPPTSRTTLAYGD
MNHEWIGNEWLPSLGLPQYRSYFMECLVDARMLDHLTKKDLRGQLKMVDSFHRNSFQCGI
MCLRRLNYDRKELERKREESQNETRDVLVWSNDRVIRWILSIGLKEFANNLIESGVHGAL
LALDETFDFSALALLLQIPTQNTQARAVLEREFNNLLVTGTDRRFDEDDDKSFRRAPSWR
KKFRPKDIRGLASGSAETLPANFRVTSSMSSPSMQPKKVQMDVYPHYFYR
NT seq 3573 nt NT seq  +upstreamnt  +downstreamnt
atgatgtgcgaggtgatgccgaccattagtgaagcggaaggacccccaggaggaggtggg
agccatgggtcaggctccccttcccagccagacgctgattcgcattttgagcagctcatg
gtttccatgctggaagagcgagaccgccttctggacacactgagagagacacaagaaacg
ctggcattaacccaggggaagttgcatgaagttggtcatgaaagagattctttgcagagg
cagctcaacactgcacttccacaggagtttgctgcactcacgaaggaactcaatgtgtgt
cgggagcagcttctggagagagaggaagaaattgctgagctgaaggcagagaggaacaac
actaggctgctgttggagcacctagagtgccttgtctccaggcacgagcgctctctacgt
atgacagtggtgaagaggcaggcacagtcacctgcgggcgtgtccagtgaggtggaggtt
ctgaaagccctgaagtcactgtttgagcaccacaaagccttggatgagaaggtacgagag
cgattacgagtagctctggagagatgcagcttgttagaagaggagctaggtgccacccac
aaagagctaatgattcttaaagaacagaacagtcagaagaaagcactaacagagggaatg
cttgatgggaaccacgaacaggaaaatgcaccgagcaccaacggcaagagatcttccgat
ggctccttgagccatgaggatcttgccaaagtgctggagctgcaggaagtcatagacagg
caggctcgagagcagagccagatgaaggagcgcctggcctccctgtccagtcatgcagca
gagctggaagaggatctggacacagctagaaaagacctcatcaagtctgaagagatgaat
acgaaactgcagcgagaagtccgagaagcaatggcccagaaggaggatatggaggagaga
atcaccacccttgagaaacgctacctcgccgcacagcgtgaagccacgtctgtgcatgac
ctcaatgacaaacttgaaaatgaaattgcaaataaagactccatgcaccgacagacagag
gacaagaaccgccagttgcaagaacgtctggaattggcagagcagaagctgcagcagacc
ctgcgcaaagctgagacgctgccagaggtggaggctgagctggcccagagggtggctgca
ctctccaaggctgaggagagacatggcaacattgaagagaggctgcggcagatggaggca
cagctggaggagaagaatcaggagctgcagcgggcaagacagagagaaaagatgaatgag
gaacataataagcgcctgtctgacactgtggacaagttgctctcagaatccaatgagagg
ctgcagctgcatctgaaggagagaatggcggcgctggaggacaagaattctctgctaagg
gaagttgaaaatgcaaagaagcaactagaagagacccagcatgataaggaccaacttgtc
ttgaatattgaagccctgaaggctgagctggagcagatgagactgagaggttcttcactt
catcatggccgaccccatttgggcagtgtcccggacttcaggttctctgtggcagacggg
catgtggatgcttacagcaccagtgcagtgttgcggcgcccccagaagggccggctggca
gcgctgcgggacgagccctccaaggtgcagaccctcaatgaacaggactgggaacgggcc
caacaagccagcgtcttggcaaatgtggcacaggcatttgagagtgatgtggatgtgtct
gatggtgaagatgaccgagacactctgctcagctcagttgatctgctgtcacccagtggg
caagctgatgcccagaccctggccatgatgcttcaggaacagctggatgcgatcaacaaa
gagatcagactgatccaagaagagaaggagaatacagagcagcgggcagaggagatcgag
agcagagtgggcagtggaagcttggacaatcttggtcgttttagatcaatgagctccata
cccccctaccctgcttcctcgcttgccggctcctctcctccaggcagtggtcggtccaca
cccagaagggtccctcacagtcctgcccgggaggtggacaggctgggtgtcatgactctg
ttgccagcttccagagaagaggtacgagacgacaagacgacgataaaatgtgaaacctcc
cccccatcctccccaaggcctctgcgcttagacaggctgcacaagggtgcgctgcacacg
gtcagccatgaggacatcagggatctgaggaactccacaggctcccaggatggtcccgtg
agcaaccctagcagcagcaatagtagccaggactccctccacaaagccccaaagaagaag
ggcatcaaatcctccattggccgcttatttgggaagaaggaaaagggccggcctggtccg
ctgggcaaggagtcaccagggcaagctggtgtttcagagacagaaaattcatctcaagat
gccttgggactcagcaaactgggagggcaagctgagaaaaaccggaaacttcagaaaaag
catgagctgctggaggaggcccgcaggcaaggcttgcctttcgcacagtgggatgggcca
actgtggtggtgtggctagagctctgggttgggatgcctgcctggtatgtggctgcttgc
cgagcaaacgtcaagagtggtgccattatgtcagccctgtcagacactgagatccagcgg
gagattggcatcagcaaccccttgcacaggctgaagctgcggctggctatccaagagata
atgtcactgactagcccttctgctccacccacatctaggacgacgctagcatatggggac
atgaaccacgagtggattggcaacgagtggctgcccagcttgggcctgccgcagtaccgc
agctacttcatggagtgccttgtcgatgcccggatgctggatcacctgaccaagaaagac
cttcgagggcagctgaagatggtcgacagcttccatagaaacagtttccagtgtggaatt
atgtgcctgagaaggttgaattatgatcgaaaagaactggaaagaaaacgagaagagagt
cagaatgagacaagagatgtgcttgtttggagcaatgatcgggtgattcgctggatcctg
tcgatcggccttaaagagtttgccaacaacctaatagagagcggtgttcacggcgcactt
ctggccttggacgagacgttcgatttcagcgccctggcactcttgttacagattccaaca
cagaatacacaggctcgcgctgtcttggaaagagaattcaacaaccttttggtcaccggg
actgatcggaggtttgatgaggatgatgacaaaagcttcaggagggcaccttcctggagg
aagaagttcagaccaaaggacatccgtggcttggcttctggctctgcagagacgttgcct
gccaacttccgggtcacctcctctatgtcatctccctctatgcagccaaagaaggttcag
atggacgtttacccacactacttctacagatga

DBGET integrated database retrieval system