KEGG   Rattus norvegicus (rat): 293648
Entry
293648            CDS       T01003                                 

Gene name
Mrgprd
Definition
(RefSeq) mas-related G-protein coupled receptor member D
  KO
K08392  Mas-related G protein-coupled receptor member D
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04614  Renin-angiotensin system
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09152 Endocrine system
   04614 Renin-angiotensin system
    293648 (Mrgprd)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rno04030]
    293648 (Mrgprd)
G protein-coupled receptors [BR:rno04030]
 Rhodopsin family
  Others
   Mas proto-oncogene and Mas-related (MRGs)
    293648 (Mrgprd)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srx
Other DBs
NCBI-GeneID: 293648
NCBI-ProteinID: NP_001001506
RGD: 738040
Ensembl: ENSRNOG00000013448
UniProt: Q7TN41 W8W3F8
Position
1
AA seq 319 aa
MNYTPYSSPAPGLTISPTMDPVTWVYFSVTFLAMATCVCGIVGNSMVIWLLSFHRVQRSP
FCTYVLNLAVADLLFLLCMASLLSLETGPLLTASTSARVYEGMKRIKYFAYTAGLSLLTA
ISTQRCLSVLFPIWYKCHRPQHLSGVVCGVLWALALLMNFLASFFCVQFWHPDKYQCFKV
DMVFNSLILGIFMPVMVLTSAIIFIRMRKNSLLQRRQPRRLYVVILTSVLVFLTCSLPLG
INWFLLYWVELPQAVRLLYVCSSRFSSSLSSSANPVIYFLVGSQKSHRLQESLGAVLGRA
LQDEPEGRETPSTCTNDGV
NT seq 960 nt   +upstreamnt  +downstreamnt
atgaactacactccttatagcagcccagccccaggtctgaccatcagccccaccatggac
cctgtgacctgggtttacttttcagtgacattcctggccatggccacctgtgtgtgtggg
atagtgggcaactccatggtgatttggctactgagtttccacagggtgcagaggtccccc
ttctgcacctacgtgctcaacctggcggtggccgacctcctcttcctgctctgcatggcc
tccctgctcagtctggaaacagggcccctgctcacagccagcacctccgccagagtctac
gaggggatgaagagaatcaagtactttgcctacacagcaggcctgagcctgctgacggcc
atcagcacccagcgctgtctctccgtgcttttccccatctggtataagtgccaccggccc
cagcacctgtcgggggtggtatgtggtgtgctgtgggcactggccctcctgatgaacttc
ctggcttctttcttctgtgttcaattctggcatcccgacaaataccagtgcttcaaggtg
gacatggttttcaacagtcttatcctggggatcttcatgcccgtcatggtcctgaccagc
gccatcatcttcatccgcatgcgaaagaacagcctgctgcagagacggcagcctcggcgg
ctctacgtggtcatcctgacttccgtccttgtcttccttacctgttctctgccgttgggc
atcaactggttcttactctactgggtggaactgccgcaggccgtgaggctcctgtacgtc
tgctcatcacgcttctcctcgtctttgagcagcagcgccaacccagtcatctacttcctc
gtgggcagccagaagagccaccggctgcaggagtctctgggtgctgtgctggggcgggca
cttcaggacgagcctgaaggcagggagacgccatccacatgtactaatgatggggtctga

DBGET integrated database retrieval system