KEGG   Rattus norvegicus (rat): 29365
Entry
29365             CDS       T01003                                 

Gene name
Mpdz
Definition
(RefSeq) multiple PDZ domain crumbs cell polarity complex component
  KO
K06095  multiple PDZ domain protein
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04530  Tight junction
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    29365 (Mpdz)
SSDB
Motif
Pfam: PDZ PDZ_6 PDZ_2 L27_2 MPDZ_u10 Tricorn_PDZ L27_1 ATP-synt_DE
Other DBs
NCBI-GeneID: 29365
NCBI-ProteinID: NP_062069
RGD: 3105
Ensembl: ENSRNOG00000007894
UniProt: O55164
Structure
PDB: 
5DTH

Position
5q31
AA seq 2054 aa
MLETIDKNRALQAAERLQSKLKERGDVANEDKLSLLKSVLQSPLFSQILSLQTSLQQLKD
QVNVATLATANADHAHTPQFSSAIISNLQSESLLLSPSNGNLEAISGPGAPPAMDGKPAC
EELDQLIKSMAQGRHVEIFELLKPPCGGLGFSVVGLRSENRGELGIFVQEIQEGSVAHRD
GRLKETDQILAINGQVLDQTITHQQAISILQKAKDTIQLVIARGSLPHISSPRISRSPSA
ASTVSAHSNPTHWQHVETIELVNDGSGLGFGIIGGKATGVIVKTILPGGVADQHGRLCSG
DHILKIGDTDLAGMSSEQVAQVLRQCGNRVKLMIARGAVEETPAPSSLGITLSSSTSTSE
MRVDASTQKNEESETFDVELTKNVQGLGITIAGYIGDKKLEPSGIFVKSITKSSAVELDG
RIQIGDQIVAVDGTNLQGFTNQQAVEVLRHTGQTVRLTLMRKGASQEAEITSREDTAKDV
DLPAENYEKDEESLSLKRSTSILPIEEEGYPLLSTELEETEDVQQEAALLTKWQRIMGIN
YEIVVAHVSKFSENSGLGISLEATVGHHFIRSVLPEGPVGHSGKLFSGDELLEVNGINLL
GENHQDVVNILKELPIDVTMVCCRRTVPPTALSEVDSLDIHDLELTEKPHIDLGEFIGSS
ETEDPMLAMSDVDQNAEEIQTPLAMWEAGIQAIELEKGSRGLGFSILDYQDPIDPANTVI
VIRSLVPGGIAEKDGRLFPGDRLMFVNDINLENSTLEEAVEALKGAPSGMVRIGVAKPLP
LSPEEGYVSAKEDTFLCSPHTCKEMGLSDKALFRADLALIDTPDAESVAESRFESQFSPD
NDSVYSTQASVLSLHDGACSDGMNYGPSLPSSPPKDVTNSSDLVLGLHLSLEELYTQNLL
QRQHAGSPPTDMSPAATSGFTVSDYTPANAVEQKYECANTVAWTPSQLPSGLSTTELAPA
LPAVAPKYLTEQSSLVSDAESVTLQSMSQEAFERTVTIAKGSSSLGMTVSANKDGLGVIV
RSIIHGGAISRDGRIAVGDCILSINEESTISLTNAQARAMLRRHSLIGPDIKITYVPAEH
LEEFRVSFGQQAGGIMALDIFSSYTGRDIPELPEREEGEGEESELQNAAYSSWSQPRRVE
LWREPSKSLGISIVGGRGMGSRLSNGEVMRGIFIKHVLEDSPAGKNGTLKPGDRIVEVDG
MDLRDASHEQAVEAIRKAGSPVVFMVQSIVNRPRKSPLPSLPHSLYPKCSFSSTNPFAES
LQLTSDKAPSQSESESEKATLCSVPSSSPSVFSEMSSDYAQPSATTVAEDEDKEDEFGYS
WKNIQERYGTLTGQLHMIELEKGHSGLGLSLAGNKDRTRMSVFIVGIDPTGAAGRDGRLQ
IADELLEINGQILYGRSHQNASSIIKCAPSKVKIIFIRNADAVNQMAVCPGSAADPLPST
SESPQNKEVEPSITTSASAVDLSSLTNVYHLELPKDQGGLGIAICEEDTLNGVTIKSLTE
RGGAAKDGRLKPGDRILAVDDELVAGCPIEKFISLLKTAKTTVKLTVGAENPGCQAVPSA
AVTASGERKDSSQTPAVPAPDLEPIPSTSRSSTPAIFASDPATCPIIPGCETTIEISKGQ
TGLGLSIVGGSDTLLGAIIIHEVYEEGAACKDGRLWAGDQILEVNGIDLRKATHDEAINV
LRQTPQRVRLTLYRDEAPYKEEDVCDTFTVELQKRPGKGLGLSIVGKRNDTGVFVSDIVK
GGIADADGRLMQGDQILMVNGEDVRNATQEAVAALLKCSLGTVTLEVGRIKAAPFHSERR
PSQSSQVSESSLSSFSLPRSGIHTSESSESSAKKNALASEIQGLRTVEIKKGPADALGLS
IAGGVGSPLGDVPIFIAMMHPNGVAAQTQKLRVGDRIVTICGTSTDGMTHTQAVNLMKNA
SGSIEVQVVAGGDVSVVTGHQQELANPCLAFTGLTSSTIFPDDLGPPQSKTITLDRGPDG
LGFSIVGGYGSPHGDLPIYVKTVFAKGAAAEDGRLKRGDQIIAVNGQSLEGVTHEEAVAI
LKRTKGTVTLMVLS
NT seq 6165 nt   +upstreamnt  +downstreamnt
atgttggaaaccatagacaaaaaccgggccctgcaggcagcagagcgcttgcaaagcaag
ctgaaggaacgcggggatgttgcaaatgaagacaaattgagcctcctgaagtctgtcctg
cagagtccactcttcagtcagatcctgagccttcagacttctctacagcagctgaaagac
caggtaaacgttgctactttggcaactgcaaatgctgaccatgcccacacaccgcagttc
agctctgccatcatctctaatctgcaaagtgagtcacttttgctgtctccaagtaatggg
aacctcgaagcaatttctggacctggtgctccacctgccatggatggaaagcctgcctgt
gaagaacttgatcagctcatcaaaagtatggcccagggtcgccatgtggaaatatttgag
ctcctcaaacctccatgtggaggcctcggcttcagtgtcgttgggctcagaagtgaaaac
aggggagagctggggatttttgttcaggagattcaagagggcagtgtggctcacagagat
ggcagacttaaggagactgaccagatccttgccattaatggccaggtcctagatcagacg
atcacacaccagcaggccatcagcatcctgcagaaggccaaagacactatacagcttgtt
attgccagggggtctttgccgcatatctccagcccacgaatttcccgttctccatctgca
gccagcacagtttcagcccactcgaatccaactcactggcagcatgtggaaactatcgaa
cttgtgaatgatgggtctggtctgggatttggcatcataggaggaaaagcaactggtgtg
atagtcaagacaattttgcctggaggagtagctgaccagcatggtcgactatgcagtgga
gaccacattctgaagattggtgacacggacctagcagggatgagcagtgagcaagtagca
caagtcctcaggcagtgtggaaacagagttaaactgatgattgccagaggcgctgtagaa
gaaactccagcaccttcctctttgggcatcaccctctcctcttccacatctacttcagag
atgcgagttgatgcttctactcagaaaaatgaagaaagtgagacgttcgatgtggaactc
actaaaaatgtccaaggattaggaattaccattgctggctatattggagataaaaaatta
gagccttcaggaatctttgtaaagagcattacaaagagcagtgctgtggagcttgatgga
agaatccagattggagaccaaattgtagcagtcgatggcaccaaccttcagggttttacc
aatcaacaagcagtagaggtgttacgtcacacgggacagacagtgcgtctgacactgatg
aggaagggagccagccaggaagcagagattacgtcaagagaagacaccgcaaaagatgtg
gacctcccagctgaaaattatgaaaaagatgaagagtctttgtcactgaagagaagtacc
agcatactgccgattgaagaggaaggatatccactgttgtcaactgagctggaagaaact
gaagatgtgcagcaagaagctgccttgctgacaaagtggcagaggattatgggaattaac
tatgaaatagtggtggctcatgtgagcaagtttagtgagaacagtgggctgggaataagt
ctggaagcaacagtgggccaccacttcatccggtctgtgctaccagaaggccctgtggga
cacagcgggaagctcttcagtggagatgagctattggaagtcaatggtataaatttgctt
ggggaaaaccatcaagatgtggtcaatattttaaaagaacttcctatcgatgtgacaatg
gtatgttgccgtcggactgtgccaccgaccgccctgtcagaagtggatagcctggacata
catgatcttgaactaacagagaagcctcatatagacctaggagagttcattggatcctcg
gagacagaggatcccatgctggcgatgtccgatgtggatcagaatgccgaggagattcag
accccgctggccatgtgggaggcaggcattcaggccatagagctggagaaagggagcagg
ggcctgggcttcagcatcttagactaccaggaccccatcgatccagcaaacacagtaata
gtcattcgttctctggtgcctggcggcattgctgaaaaggatggacggctttttccagga
gacaggctcatgtttgtcaatgacattaacctggaaaacagcactctggaagaggccgtg
gaagccttgaagggagcgccctcagggatggtgcgtataggagtagccaagcctttgcct
ctttcaccagaagaagggtatgtttctgccaaggaagacacttttctctgctcaccgcac
acctgcaaggagatgggcctgtctgacaaagccctcttcagggctgacttggctctgata
gatacacctgatgctgagtccgtagcagaatcaagatttgagtctcagttctctcctgat
aacgacagtgtctactctacacaagcctctgtcttatctcttcatgatggtgcttgtagt
gatggcatgaactacggcccctctctgccctcatctcctcccaaggacgtgaccaacagt
tctgacctagtgctcggtctgcatttgtccctggaagaactctacacacagaacctcctt
cagagacagcatgctggctctcctcccacagacatgagcccagcagccacctctggtttc
accgtcagtgactacacacctgcaaatgctgttgaacaaaaatatgagtgtgcaaacaca
gtagcgtggactccctcgcagttgccaagtggcctaagcaccacagagctcgctcctgca
ctgcctgctgtggctccgaagtatttaacagagcagagctctctggtgtctgatgctgag
tctgtcaccctgcagagcatgtcccaggaagcctttgagaggacggttactatagcaaaa
ggcagctccagtctaggcatgacagtaagtgctaataaagatggcctgggagtgattgtg
cgaagcattattcacggaggcgccattagtcgggatggccgaattgctgttggtgactgc
attttgtccattaatgaagaatccaccatcagtttaaccaatgcccaggcacgggccatg
ctgagaagacattctctaattggacctgacataaaaattacttacgtgcctgcagaacat
ttggaagagttcagagtaagttttggtcaacaagccggaggaataatggcactggatatt
ttttcttcatacactggcagagatattccagaactcccagagcgagaagaaggagaaggg
gaagaaagtgaactgcagaatgctgcttatagcagctggagccagccccggagggtggaa
ctttggagagagcccagcaagtccttgggcatcagcattgttggtggtcgggggatgggg
agccggctgagcaacggcgaggtgatgaggggcatcttcattaaacatgttcttgaagac
agtccagctggcaaaaatggaactttgaagccgggagacagaatagttgaggtggatggg
atggacctcagagatgcaagccatgaacaagctgtggaagccattcggaaagcaggcagc
cctgtagtgtttatggtacagagcattgtaaacagaccaaggaaatcccctttgccttcc
ttgccgcacagcctttaccctaagtgcagcttcagcagcactaacccatttgcagagtct
ctccagctcacctctgacaaggcacccagccagtcagaatccgagtcggagaaggccaca
ttgtgcagtgtcccttcctcctctccttcagtgttctcagaaatgagcagtgattatgca
cagccatctgcaaccacagtcgcagaagatgaggacaaagaggatgagtttgggtacagc
tggaaaaatatccaagagcgttatggaacccttacaggccagctccatatgattgagctg
gagaaaggtcatagcggtttgggtctaagtcttgctgggaacaaagaccgaaccagaatg
agtgtgtttatagtggggattgatcctactggagcagcagggagagatggccgactacag
attgccgacgagcttttagagatcaatggccaaatattatatggcagaagtcatcagaat
gcttcatcaatcattaaatgtgctccatctaaagtaaaaatcatttttatcagaaatgca
gatgcagtgaatcagatggctgtatgtccaggaagtgcagcagaccctctaccttctacc
tcagaaagtcctcaaaataaggaggtggaaccaagtattactacatctgcttcagctgtg
gacctcagctcacttacaaatgtgtaccatctggagcttcccaaggatcaaggaggctta
ggcattgctatctgtgaggaagacacactcaatggagtcacgatcaagagcctaactgag
cgtgggggagcagccaaggatggaaggctcaaacctggggatcgcatcttggctgtagat
gatgaacttgttgctggctgtcctattgaaaagttcatcagtcttctgaagacggcaaag
acaactgtaaaactgactgttggagctgagaacccgggctgtcaggctgtcccttcagca
gctgtcacagccagcggagaaaggaaagacagctcccagacccctgcagtcccagctcca
gacctggaacccattccaagtacgagcaggtcatccacaccagcaatttttgcttctgac
cctgccacctgccccatcatccctggctgtgaaacaacaattgagatttccaaaggccaa
acaggcctgggactgagcattgtcggggggtcagacacgttgctgggtgctattattatc
catgaagtttatgaagagggagcagcatgtaaagatggaagactgtgggctggagaccag
attttagaggtaaatgggattgacctgagaaaggctacacatgatgaagcaatcaatgtc
ctgaggcagactccgcaaagagtacggctgacgctctaccgagatgaggccccatacaaa
gaggaggatgtatgtgacaccttcactgtcgagctgcagaagaggccgggcaaaggcctt
gggttgagtattgttggcaaaagaaatgacactggagtgtttgtatcagacattgttaaa
ggaggcattgcagacgccgatgggagactgatgcaaggggaccagattttaatggtgaat
ggagaagatgtccgtaatgccacccaggaagcagttgctgccctgctcaagtgttcccta
ggcacagtaaccctcgaggttggaagaatcaaagccgctccattccactcagagaggagg
ccttctcaaagcagtcaggtgagtgagagcagcctgtcatccttcagtctcccacgttct
ggaatacatacatcagaatcgtcagaaagtagtgccaagaagaatgcgttagcatctgaa
attcagggattaaggacagtcgaaataaaaaaggggcctgctgacgcgctgggactcagc
attgccggaggagtgggcagcccgctcggcgacgtcccgatatttattgccatgatgcac
ccaaatggtgttgcagctcaaacccaaaaactcagagttggggataggattgtcaccatc
tgtggcacatccactgatgggatgactcacacacaggcggttaacttgatgaaaaatgcc
tcaggctccattgaagtgcaggtggttgctggaggagatgtgagtgtggtcacgggtcat
cagcaagagcttgccaatccttgccttgctttcactgggctgacttccagcactatattt
ccggatgacttaggccctccacagtctaagaccataacactagaccgaggaccagatggc
ttaggcttcagcattgtaggtggctatggcagccctcatggagacttaccaatttatgtt
aaaacagtgttcgcaaagggagcagcggcagaagatgggcgtctaaagaggggtgatcag
atcattgctgtcaacgggcaaagtctagaaggcgtgacccatgaagaagctgttgccatc
cttaagcggacaaagggcactgtcaccctcatggttctctcttga

DBGET integrated database retrieval system