KEGG   Rattus norvegicus (rat): 293663
Entry
293663            CDS       T01003                                 

Gene name
Rbm4
Definition
(RefSeq) RNA binding motif protein 4
  KO
K13187  RNA-binding protein 4
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:rno03041]
    293663 (Rbm4)
Spliceosome [BR:rno03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   RNA binding proteins (RBPs)
    293663 (Rbm4)
SSDB
Motif
Pfam: RRM_1 RRM_5 zf-CCHC RRM_occluded RRM_7 zf-CCHC_3 zf-CCHC_2 zf-CCHC_5
Other DBs
NCBI-GeneID: 293663
NCBI-ProteinID: NP_001163955
RGD: 1306891
Ensembl: ENSRNOG00000050741
UniProt: D4A1W5
Position
1q43
AA seq 365 aa
MVKLFIGNLPREATEQEIRSLFEQYGKVLECDIIKNYGFVHIEDKTAAEDAIRNLHHYKL
HGVNINVEASKNKSKASTKLHVGNISPTCTNQELRAKFEEYGPVIECDIVKDYAFVHMER
AEDAVEAIRGLDNTEFQGKRMHVQLSTSRLRTAPGMGDQSGCYRCGKEGHWSKECPIDRS
GRVADLTEQYNEQYGAVRTPYTMSYGDSLYYNNTYGALDAYYKRCRAARSYEAVAAAAAS
AYNNYAEQTLSQLPQVQNTAMASHLTSTSLDPYNRHLLPPSGAAAAAAAAAAAAAACTAA
STPYYGRDRSPLRRATGPVPTVGEGYGYGHDSELSQASAAARNSLYDMARYEREQYADRA
RYSAF
NT seq 1098 nt   +upstreamnt  +downstreamnt
atggtgaaactgttcatcggaaatctgccccgggaggccacagagcaggagatccgctca
ctcttcgagcagtacgggaaggtgctggaatgtgacatcattaagaactatggctttgtg
cacatagaggacaagacggccgctgaggatgccatacgcaacctgcaccactacaaactg
cacggagtgaacatcaatgtggaagccagcaagaataagagcaaagcttcaaccaaatta
catgtgggcaacatcagtcccacttgtaccaaccaagagcttcgggccaagtttgaggag
tacggcccagtcatcgaatgtgacatcgtgaaagattatgcctttgtacacatggagcgg
gcagaagatgcggtggaggccatcaggggccttgacaacacagagtttcaaggcaaacga
atgcacgtgcagttgtccaccagccggcttaggaccgcgcccgggatgggagaccagagc
ggctgctatcggtgcgggaaagaggggcactggtccaaagagtgtccgatagaccgttcg
ggccgtgtggcagacttgaccgagcaatataatgagcaatatggagcagtgcgtacgcct
tacaccatgagttatggggattcattgtattacaacaacacgtacggagcgctcgatgcc
tactacaagcgctgccgtgctgcccggtcctatgaggcagtggcagctgcagctgcctct
gcatataataactatgcagagcagactttgtcccagctgccacaagtccagaacacagcc
atggccagtcacctcacctccacctctcttgatccctacaatagacatctgttgccgcct
tcaggagctgctgcagcagcagctgctgctgctgctgctgctgctgcttgtactgcagct
tctactccatattacgggcgggatcggagccccctgcgtcgcgctacaggcccagttccc
actgttggagagggctacggttacgggcatgacagtgagttgtcccaagcttcagcagct
gctcggaattccctgtacgacatggcccggtatgagcgggagcagtatgcggatcgggcg
cggtactcagccttttaa

DBGET integrated database retrieval system