KEGG   Rattus norvegicus (rat): 293668Help
Entry
293668            CDS       T01003                                 

Gene name
Brms1
Definition
(RefSeq) breast cancer metastasis-suppressor 1
  KO
K19196  breast cancer metastasis-suppressor 1 and related proteins
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rno03036]
    293668 (Brms1)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic Type
  Histone modification proteins
   HDAC complexes
    Sin3A-HDAC complex
     293668 (Brms1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sds3 Dynactin_p62 PIP5K Vfa1
Motif
Other DBs
NCBI-GeneID: 293668
NCBI-ProteinID: NP_001009605
RGD: 1311057
Ensembl: ENSRNOG00000020117
UniProt: Q5M7T3
Position
1q43
AA seq 246 aa AA seqDB search
MPIQPSGKETEEMEAEGDSAAEMNGEADESEEERSGSQTESEEESSEMDDEDYERRRSEC
VSEMLDLEKQFSELKEKLFRERLSQLRLRLEEVGAERAPEYTEPLGGLQQSLKIRIQVAG
IYKGFCLDVIRNKYECELQGAKQHLESEKLLLYDTLLGELQERIQRLEEDRQSLDISSEW
WDDKLHSRGSSKTWDSVPPSKRKKAPLVSGPYIVYMLQEIDILEDWTAIKKARAAVSPQK
RKADGP
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgcccatccagccttcagggaaagaaacagaagagatggaggcagaaggcgattcagca
gctgagatgaacggggaggcagatgagagtgaggaggaacggagcggcagccagactgag
tcagaggaggagagctcagagatggatgacgaggactatgagcggcgccgcagtgagtgt
gtcagtgagatgctggacctggaaaagcagttctcggagctgaaggagaagttgttcagg
gaacggctgagccagctgcgattacgactggaggaagtgggggccgagagagccccagaa
tatacagagcctcttggagggctacagcagagcctaaagattcgtattcaggtggcaggg
atctacaagggcttctgtctggatgtgatcaggaataagtatgaatgtgaactacaggga
gccaaacagcacctcgagagtgagaagctgctgctgtatgacacactgcttggggagctg
caggagcggatccagaggctggaggaggacagacagagcctggacatcagctctgagtgg
tgggacgacaaactacatagcaggggcagttcgaagacctgggactcagtgccacccagc
aagaggaagaaggcaccactcgtttctggcccatacattgtgtacatgctgcaggagatc
gacatcctggaagactggacggccatcaaaaaggccagggcagcagtgtcccctcagaag
agaaaagcagatggaccctga

DBGET integrated database retrieval system