KEGG   Rattus norvegicus (rat): 293684
Entry
293684            CDS       T01003                                 

Gene name
Scyl1
Definition
(RefSeq) SCY1 like pseudokinase 1
  KO
K08876  SCY1-like protein 1
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rno01001]
    293684 (Scyl1)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:rno03016]
    293684 (Scyl1)
Protein kinases [BR:rno01001]
 Serine/threonine kinases: Other
  SCY1 family [OT]
   293684 (Scyl1)
Transfer RNA biogenesis [BR:rno03016]
 Eukaryotic type
  tRNA transport factors
   tRNA export factors
    293684 (Scyl1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr HEAT Kinase-like Cnd1
Other DBs
NCBI-GeneID: 293684
NCBI-ProteinID: NP_001011938
RGD: 1307330
Ensembl: ENSRNOG00000023668
Vega: OTTRNOG00000002279
UniProt: Q5M9F8
Position
1q43
AA seq 807 aa
MWFFARDPVRDFPFELNPEPPEGGPPGPWVLHRGRKKATGSAVSIFVYDVKPGAEEQTQV
AKAAFKRLKTLRHPNILAYIDGLETEKCLHIVTEAVTPLGTYLKARAEAGGLKEQELSWG
LHQIVKALSFLVNDCNLIHNNVCMAAVFVDKAGEWKLGGLDYMYSAQGNGGGPPNKGIPE
LEQYDPPELADSSSRAVKEKWSADMWRLGCLIWEVFNGSLPRATALRNPGKIPKSLVTHY
CELVGANPKVRPNPARFLQNCRAPGGFMSNRFVETNLFLEEIQIKEPAEKQKFFQELSKS
LDSFPEDFCRHKVLPQLLTAFEFGNAGAVVLTPLFKVGKFLSAEEYQQKIIPVVVKMFSS
TDRAMRVRLLQQMEQFIQYLDEPTVNTQIFPHVTHGFLDTNPAIREQTVKSMLLLAPKLS
ETNLNVELLKHFARLQAKDDQGPIRCNTTVCLGKIGSYLSASTRHRVLTSAFSRATKDPF
APSRVAGVLGFAATHNLYSMDDCAHKILPVLCGLTVDPEKSVRDQAFKTIRSFLSKLESV
SEDPTQLAEIEKDVHAASSPGTGGAAASWAGWAVTGVSSLTSKLIRTHPTPVPSEAAVPQ
RPVPEGDPAPAPAPASATPATSGHRETQEEDKDAAEDSATADRWDDEDWGSLEQEAESVL
AQQDDWSTKGQGNRAGQVSHSDHKSLDSHWSSWEVEGSWDQGWQEPSSVEPPPEGTRLAS
EYNWGGAEPSDKGDPFAALSVRPSTQPRPDPDSWGEDNWEGLEAESRQVKAELARKKREE
RRREMEAKRAEKKATKGPMKLGARKLD
NT seq 2424 nt   +upstreamnt  +downstreamnt
atgtggttctttgcccgggacccggtccgggacttcccgttcgagctgaaccctgagccc
cccgaaggcggaccgcccgggccctgggtcctgcaccgaggccgcaaaaaggccacaggc
agtgcggtgtccatcttcgtgtacgatgtgaaacccggagccgaagagcagacccaggtg
gccaaagctgccttcaaacgcctcaaaactctccgacaccccaacatcctggcctatatc
gatgggttggagacagaaaagtgcctccacatcgtgacagaggctgtgaccccactggga
acatacctcaaggcacgagcagaagcaggtggtctgaaggagcaggagctgtcatggggg
ttacaccagatcgtgaaagccctcagcttcctggtcaacgactgcaacctcatccacaac
aatgtctgcatggctgctgtgtttgtggacaaggctggcgagtggaaacttgggggtctg
gactacatgtactcagcacagggcaacggtgggggaccacccaacaaggggatccctgag
cttgagcagtatgatcctccggagttggctgatagcagcagcagagcagtcaaagagaag
tggtcagcagacatgtggcgcttgggctgcctcatctgggaagttttcaatgggtctcta
cctcgggcaactgccctgcgcaaccctgggaagatccccaaatccctggtcacccattac
tgcgagctggtgggagctaaccccaaagtacgtcccaacccggcccgcttcctgcagaac
tgccgggcacctggtggcttcatgagcaaccgctttgtggagaccaacctgttcctggag
gagattcagatcaaagagccagctgagaagcagaagttcttccaagagctgagcaagagt
ctagactcgtttcctgaagatttctgtcgacacaaggtgctgccccagctgctgactgcc
tttgagtttggcaatgctggggccgtggtcctcacacctctcttcaaggtggggaaattc
ctcagtgctgaagaataccagcagaagatcatccccgtggtggttaagatgttctcatcc
actgaccgtgccatgcgcgtccgcctcctccagcagatggagcagttcatccaatacctt
gatgagccgacagtcaacacccagatcttcccccacgtcactcatggctttctggacacc
aaccctgccatccgggagcagactgtcaagtccatgctgctcttggccccaaagctgagt
gagaccaacctcaatgtggagctgctgaagcacttcgcaaggctgcaagccaaggacgac
cagggtcccatccgctgcaacaccacggtctgcttgggcaaaatcggctcctacctcagt
gctagtactagacacagggtcctcacctctgccttcagccgggccactaaggacccattt
gcaccatcccgggttgcgggtgtcctgggcttcgctgctacacacaatctctactcaatg
gatgactgtgcccataagatcctgcctgtgctctgcggccttactgtagaccctgaaaaa
tctgtgcgggaccaggcctttaagaccattcgaagcttcctgtccaaattagagtctgtg
tcggaggatcctacccagttggcagaaatagagaaggacgtccatgcagcatccagccct
ggaacaggaggagctgcagccagctgggcaggctgggctgtgaccggggtgtcatctctc
acctccaagctgatccgaacacaccccacacctgtgccgtctgaggccgctgtgccccag
agaccagtgccagagggagaccctgctccagctccagcccctgcctctgccacccctgcg
acctcaggccaccgggaaacacaggaagaagacaaggacgctgcagaagacagcgccact
gccgacagatgggatgatgaggactggggcagcttggagcaggaagccgagtctgtgttg
gcgcagcaggatgactggagcaccaagggccaagggaatcgagctggacaggtcagccat
tcagaccacaaatctctggactcacactggagcagctgggaagttgagggctcctgggac
cagggctggcaggaacccagttctgtggagccacccccagaaggaacccggctagccagc
gagtataactggggtggtgcagagcccagtgacaagggtgacccctttgctgccctgtct
gttcgtcccagcacccagcccaggccagacccagactcctggggtgaggacaactgggaa
ggcttggaggctgaaagcaggcaggtgaaggcagagctagcccgaaaaaagcgagaggaa
aggagaagagaaatggaagccaagcgggcggagaaaaaggccaccaaggggcccatgaag
ctgggagcccggaagctggactga

DBGET integrated database retrieval system