KEGG   Rattus norvegicus (rat): 293686
Entry
293686            CDS       T01003                                 

Gene name
Slc22a20, Gm963
Definition
(RefSeq) solute carrier family 22, member 20
  KO
K08216  MFS transporter, OCT family, solute carrier family 22 (organic anion transporter), member 20
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rno02000]
    293686 (Slc22a20)
Transporters [BR:rno02000]
 Solute carrier family (SLC)
  SLC22: Organic cation/anion/zwitterion transporter
   293686 (Slc22a20)
 Major facilitator superfamily (MFS)
  Organic acid transporters
   Organic cation transporter (OCT) family [TC:2.A.1.19]
    293686 (Slc22a20)
SSDB
Motif
Pfam: Sugar_tr MFS_1 Spore_YtrH
Other DBs
NCBI-GeneID: 293686
NCBI-ProteinID: NP_001099797
RGD: 1311460
Ensembl: ENSRNOG00000022673
UniProt: D3ZXZ4
Position
1q43
AA seq 355 aa
MAFTDLLDALGGVGRFQLVYTALLLLPCGLLACHTFLQNFTAAAPPHHCQHPANYTEATT
NDSGAWLRATIPLNQHGVPEPCQRYTEPQWALLEPNTSSHGVATEGCKDGWVYDRSIFPS
TIVMEWDLVCEARTLRDLAQSIYMSGVLVGAALFGSLADRLGRKAPLVWSYLQLAVSGAV
TAYVGSFSAYCIFRFLMGMTFSGIILNSLSLVVEWMPTRGRTVAGILLGFSFTLGQLILA
GVAYLIRPWRWLQFAVSAPFLVFFLYSWWLPESSRWLLLHGKAQQAVQNLRKVAMMNGRK
AEGERLTIEVSGCSLTPWLTTAWPWTCRSSGSASTWYRLCLGSSTSQPCWLPPPL
NT seq 1068 nt   +upstreamnt  +downstreamnt
atggccttcacagacctgctggatgccctgggcggtgtgggtcgcttccagcttgtctat
acagccttgctgttgctgccctgtgggctgctggcctgccacaccttcctacagaacttc
acggctgctgcgccccctcaccactgccagcatcctgccaactacacagaagctaccacc
aatgactcaggagcctggctgagggccaccatacccctgaaccaacatggggttcctgag
ccatgccagcgctacacagagcctcagtgggcccttctggaacccaacacctcctcccat
ggagtggccacagagggctgcaaggatggttgggtctatgaccggagcattttcccatct
actattgtgatggagtgggacctggtgtgtgaggcccgcacccttcgtgacctggctcag
tccatctacatgtccggggtgctggtgggagccgccttgtttggtagccttgccgacagg
ttgggtcgcaaggccccgctggtctggtcgtacctgcaactggcagtttcaggggctgtc
acagcctatgtgggctccttcagtgcctactgcatcttccggttcctgatgggcatgacc
ttctctggcatcatcctcaactccctctccctggttgtagaatggatgccaaccaggggc
cggacggtggcaggcatcttgctgggtttctccttcaccttgggtcagctcatcctggct
ggcgtggcatacctgatccgcccctggcgatggctgcagtttgctgtgtctgctcctttc
ctggtctttttcctctactcttggtggcttccagagtcatcccgatggctcctccttcac
ggcaaggcccagcaagctgtgcagaacctacggaaggtggccatgatgaatggcaggaag
gcggaaggggaaaggctgactatagaggtgagcggatgttctctaactccgtggcttact
acggcctggccatggacctgcagaagttcgggctcagcatctacctggtacaggctctgt
ttgggatcatcgacatcccagccatgctggttgccaccaccactatga

DBGET integrated database retrieval system